DR067363

Information for DR067363

NameDR067363
AccessionID1447
Length162 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_016374 Vco01
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession DR067363
Sequence
GGCTACGATTGGTGCTCTGGTCATGAACGGGGCTACCATGGAGGTTGGAGCGGTTGCTGC
CATGAGGTATGTGAAAGATGGTATCAGAGCTGCTAGATTAGTAATGCTGCATACTGAACA
TACAATGCTAGTTGGAGACCACGCCTCAGCCTTCGCCATTTC
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0016787 molecular_function hydrolase activity

KEGG Analysis

Analysis Date: 01-18-2011 (KEGG analysis for Vaccinium corymbosum unigene v1)
K01444 E3.5.1.26; N4-(beta-N-acetylglucosaminyl)-L-asparaginase [EC:3.5.1.26]

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: DR067363_2_ORF1 CRC64: 46EF49FF6756FB85 LENGTH: 53 aa
InterPro
IPR000246
Family
Peptidase T2, asparaginase 2
PTHR10188 [2-53]T 3.5e-19 PTHR10188 PROTEASE T2 ASPARAGINASE PROTEASE T2 ASPARAGINASE
PF01112 [2-52]T 2.1e-14 PF01112 Asparaginase_2 Asparaginase_2
noIPR
unintegrated
unintegrated
PTHR10188:SF6 [2-53]T 3.5e-19 PTHR10188:SF6 N(4)-(BETA-N-ACETYLGLUCOSAMINYL)-L-ASPARAGINASE N(4)-(BETA-N-ACETYLGLUCOSAMINYL)-L-ASPARAGINASE
SSF56235 [5-53]T 8e-14 SSF56235 N-terminal nucleophile aminohydrolases (Ntn hydrolases) N-terminal nucleophile aminohydrolases (Ntn hydrolases)

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: DR067363
Best 10 Hits Shown

Match Name E value Identity Description
ppa007409m 1.72e-1778.85%ppa007409m
HSP 1
Score: 83.9593 bits (206), Expect = 1.72425e-17
Identity = 41/52 (78.85%), Postives = 48/52 (92.31%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
TI ALVM+G TMEVGAVAAMRY+KDGI+AARLVM +TEHT+LVG+ A+AFAI
Sbjct: 103 TIDALVMDGVTMEVGAVAAMRYIKDGIKAARLVMQYTEHTLLVGEQAAAFAI 154

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: DR067363
Best 10 Hits Shown

Match Name E value Identity Description
ASPG3_ARATH1.94e-1476.47%
Probable isoaspartyl peptidase/L-asparag...
HSP 1
Score: 77.7962 bits (190), Expect = 1.94092e-14
Identity = 39/51 (76.47%), Postives = 45/51 (88.24%), Query Frame = 2
Query:    8 IGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
I ALVM+G TMEVGAVAAMRYVKDGIRAA LVM +++HT+L G+ ASAFAI
Sbjct: 93 IDALVMDGVTMEVGAVAAMRYVKDGIRAAHLVMKYSQHTLLAGEGASAFAI 143

ASPG1_DROYA8.15e-1368.63%
Putative N(4)-(beta-N-acetylglucosaminyl...
HSP 1
Score: 72.4034 bits (176), Expect = 8.15455e-13
Identity = 35/51 (68.63%), Postives = 43/51 (84.31%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFA 157
T+ A+VM+GATMEVGAVA +R +KD I+ AR V+ HT+HTMLVGD ASAFA
Sbjct: 122 TLDAMVMDGATMEVGAVAGLRRIKDAIKVARHVLEHTQHTMLVGDAASAFA 172

ASPG1_DROSI1.82e-1266.67%
Putative N(4)-(beta-N-acetylglucosaminyl...
HSP 1
Score: 71.2478 bits (173), Expect = 1.81664e-12
Identity = 34/51 (66.67%), Postives = 43/51 (84.31%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFA 157
T+ A+VM+GATM+VGAVA +R +KD I+ AR V+ HT+HTMLVGD ASAFA
Sbjct: 119 TLDAMVMDGATMDVGAVAGLRRIKDAIKVARHVLEHTQHTMLVGDAASAFA 169

ASPG1_DROSE1.82e-1266.67%
Putative N(4)-(beta-N-acetylglucosaminyl...
HSP 1
Score: 71.2478 bits (173), Expect = 1.81664e-12
Identity = 34/51 (66.67%), Postives = 43/51 (84.31%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFA 157
T+ A+VM+GATM+VGAVA +R +KD I+ AR V+ HT+HTMLVGD ASAFA
Sbjct: 119 TLDAMVMDGATMDVGAVAGLRRIKDAIKVARHVLEHTQHTMLVGDAASAFA 169

ASPG1_DROME1.82e-1266.67%
Putative N(4)-(beta-N-acetylglucosaminyl...
HSP 1
Score: 71.2478 bits (173), Expect = 1.81664e-12
Identity = 34/51 (66.67%), Postives = 43/51 (84.31%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFA 157
T+ A+VM+GATM+VGAVA +R +KD I+ AR V+ HT+HTMLVGD ASAFA
Sbjct: 119 TLDAMVMDGATMDVGAVAGLRRIKDAIKVARHVLEHTQHTMLVGDAASAFA 169

ASPG1_DROER1.82e-1266.67%
Putative N(4)-(beta-N-acetylglucosaminyl...
HSP 1
Score: 71.2478 bits (173), Expect = 1.81664e-12
Identity = 34/51 (66.67%), Postives = 43/51 (84.31%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFA 157
T+ A+VM+GATM+VGAVA +R +KD I+ AR V+ HT+HTMLVGD ASAFA
Sbjct: 122 TLDAMVMDGATMDVGAVAGLRRIKDAIKVARHVLEHTQHTMLVGDAASAFA 172

ASPG1_DROPS1.70e-1058.82%
Putative N(4)-(beta-N-acetylglucosaminyl...
HSP 1
Score: 64.6994 bits (156), Expect = 1.70033e-10
Identity = 30/51 (58.82%), Postives = 42/51 (82.35%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFA 157
T+ A++M+G++M+VGAVA +R +KD IR AR V+ HT+H+MLVGD AS FA
Sbjct: 116 TLDAMIMDGSSMDVGAVAGLRGIKDAIRVARHVLEHTKHSMLVGDLASQFA 166

ASPG1_DROPE4.95e-1056.86%
Putative N(4)-(beta-N-acetylglucosaminyl...
HSP 1
Score: 63.1586 bits (152), Expect = 4.9472e-10
Identity = 29/51 (56.86%), Postives = 42/51 (82.35%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFA 157
T+ A++M+G++M+VGAVA +R +KD IR AR V+ HT+H++LVGD AS FA
Sbjct: 116 TLDAMIMDGSSMDVGAVAGLRGIKDAIRVARHVLEHTKHSILVGDLASQFA 166

ASPG1_DROGR3.21e-0951.92%
Putative N(4)-(beta-N-acetylglucosaminyl...
HSP 1
Score: 60.4622 bits (145), Expect = 3.20668e-09
Identity = 27/52 (51.92%), Postives = 38/52 (73.08%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
T+ A+VM+G M+VGAV +R +K+ IR AR V+ HT HT+LVG A+ FA+
Sbjct: 122 TLDAMVMDGGLMDVGAVGGLRNIKEAIRVARFVLEHTSHTLLVGQSATDFAV 173

ASPG_RAT9.33e-0950.00%
N(4)-(Beta-N-acetylglucosaminyl)-L-aspar...
HSP 1
Score: 58.9214 bits (141), Expect = 9.33001e-09
Identity = 26/52 (50.00%), Postives = 38/52 (73.08%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
T+ A++M+G M+VGAV +R +K+ I AR V+ HT HT+LVGD A+ FA+
Sbjct: 86 TLDAMIMDGTAMDVGAVGGLRRIKNAIGVARKVLEHTTHTLLVGDSATKFAV 137

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: DR067363
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0014s188506.70e-1880.77%POPTR_0014s18850.1
HSP 1
Score: 85.8853 bits (211), Expect = 6.6958e-18
Identity = 42/52 (80.77%), Postives = 48/52 (92.31%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
TI AL+MNG TMEVGAVAAMR+VKDGIRAA+LVM HT+HT+LVG+ ASAFAI
Sbjct: 92 TIDALIMNGVTMEVGAVAAMRFVKDGIRAAKLVMQHTKHTLLVGEKASAFAI 143

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: DR067363
Best 10 Hits Shown

Match Name E value Identity Description
B9R9W8_RICCO4.97e-1682.69%
N(4)-(Beta-n-acetylglucosaminyl)-l-aspar...
HSP 1
Score: 87.4261 bits (215), Expect = 4.96969e-16
Identity = 43/52 (82.69%), Postives = 48/52 (92.31%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
TI ALVMNG TMEVGAVAAMRYVKDGI+AA+LVM HT+HT+LVG+ ASAFAI
Sbjct: 91 TIDALVMNGVTMEVGAVAAMRYVKDGIKAAKLVMQHTQHTLLVGEQASAFAI 142

D7U7C1_VITVI8.48e-1682.69%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 86.6557 bits (213), Expect = 8.477e-16
Identity = 43/52 (82.69%), Postives = 48/52 (92.31%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
T+ ALVMNGATMEVGAVAAM+YVKDGI+AARLVM HT HT+LVG+ ASAFAI
Sbjct: 90 TLDALVMNGATMEVGAVAAMKYVKDGIKAARLVMQHTGHTLLVGEQASAFAI 141

B9IBA8_POPTR1.45e-1580.77%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 85.8853 bits (211), Expect = 1.44596e-15
Identity = 42/52 (80.77%), Postives = 48/52 (92.31%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
TI AL+MNG TMEVGAVAAMR+VKDGIRAA+LVM HT+HT+LVG+ ASAFAI
Sbjct: 76 TIDALIMNGVTMEVGAVAAMRFVKDGIRAAKLVMQHTKHTLLVGEKASAFAI 127

B4FNJ8_MAIZE1.89e-1578.85%
Putative uncharacterized protein OS=Zea ...
HSP 1
Score: 85.5001 bits (210), Expect = 1.88848e-15
Identity = 41/52 (78.85%), Postives = 49/52 (94.23%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
T+ ALVMNGATME+GAVAAMRYVKDGI+AA+LVM H+EHT+LVG+ A+AFAI
Sbjct: 100 TLDALVMNGATMEIGAVAAMRYVKDGIKAAKLVMEHSEHTLLVGEKATAFAI 151

C6T5A4_SOYBN2.47e-1580.77%
Putative uncharacterized protein (Fragme...
HSP 1
Score: 85.1149 bits (209), Expect = 2.46643e-15
Identity = 42/52 (80.77%), Postives = 47/52 (90.38%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
TI AL+M+G TMEVGAVAAMRYVKDGI+AARLVM HTEHT+LVG+ AS FAI
Sbjct: 90 TIDALIMDGVTMEVGAVAAMRYVKDGIKAARLVMQHTEHTLLVGEKASEFAI 141

Q5CAG8_ORYSA1.22e-1475.00%
OSJNBa0065H10.15 protein OS=Oryza sativa...
HSP 1
Score: 82.8037 bits (203), Expect = 1.22408e-14
Identity = 39/52 (75.00%), Postives = 48/52 (92.31%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
T+ AL+M+G TME+GAVAAMRYVKDGIRAA+LVM HTEHT+LVG+ A++FAI
Sbjct: 133 TLDALIMDGTTMEIGAVAAMRYVKDGIRAAKLVMDHTEHTLLVGEKATSFAI 184

Q0JB91_ORYSJ1.22e-1475.00%
Os04g0549300 protein OS=Oryza sativa sub...
HSP 1
Score: 82.8037 bits (203), Expect = 1.22408e-14
Identity = 39/52 (75.00%), Postives = 48/52 (92.31%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
T+ AL+M+G TME+GAVAAMRYVKDGIRAA+LVM HTEHT+LVG+ A++FAI
Sbjct: 104 TLDALIMDGTTMEIGAVAAMRYVKDGIRAAKLVMDHTEHTLLVGEKATSFAI 155

Q01I22_ORYSA1.22e-1475.00%
OSIGBa0106P14.8 protein OS=Oryza sativa ...
HSP 1
Score: 82.8037 bits (203), Expect = 1.22408e-14
Identity = 39/52 (75.00%), Postives = 48/52 (92.31%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
T+ AL+M+G TME+GAVAAMRYVKDGIRAA+LVM HTEHT+LVG+ A++FAI
Sbjct: 104 TLDALIMDGTTMEIGAVAAMRYVKDGIRAAKLVMDHTEHTLLVGEKATSFAI 155

D7MV31_ARALY3.94e-1376.47%
Putative uncharacterized protein OS=Arab...
HSP 1
Score: 77.7962 bits (190), Expect = 3.93772e-13
Identity = 39/51 (76.47%), Postives = 45/51 (88.24%), Query Frame = 2
Query:    8 IGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
I ALVM+G TMEVGAVAAMRYVKDGIRAA LVM +++HT+L G+ ASAFAI
Sbjct: 93 IDALVMDGVTMEVGAVAAMRYVKDGIRAAHLVMKYSQHTLLAGEGASAFAI 143

A2XW61_ORYSI1.07e-1080.49%
Putative uncharacterized protein OS=Oryz...
HSP 1
Score: 69.707 bits (169), Expect = 1.07234e-10
Identity = 33/41 (80.49%), Postives = 39/41 (95.12%), Query Frame = 2
Query:   38 MEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
ME+GAVAAMRYVKDGIRAA+LVM HTEHT+LVG+ A++FAI
Sbjct: 1 MEIGAVAAMRYVKDGIRAAKLVMDHTEHTLLVGEKATSFAI 41

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: DR067363
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010139910012.28e-1882.69%GSVIVT01013991001 assembled CDS
HSP 1
Score: 86.6557 bits (213), Expect = 2.28273e-18
Identity = 43/52 (82.69%), Postives = 48/52 (92.31%), Query Frame = 2
Query:    5 TIGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
T+ ALVMNGATMEVGAVAAM+YVKDGI+AARLVM HT HT+LVG+ ASAFAI
Sbjct: 90 TLDALVMNGATMEVGAVAAMKYVKDGIKAARLVMQHTGHTLLVGEQASAFAI 141

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: DR067363
Best 10 Hits Shown

Match Name E value Identity Description
AT5G61540.1 1.55e-1576.47%
N-terminal nucleophile aminohydrolases ...
HSP 1
Score: 77.7962 bits (190), Expect = 1.55059e-15
Identity = 39/51 (76.47%), Postives = 45/51 (88.24%), Query Frame = 2
Query:    8 IGALVMNGATMEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
I ALVM+G TMEVGAVAAMRYVKDGIRAA LVM +++HT+L G+ ASAFAI
Sbjct: 93 IDALVMDGVTMEVGAVAAMRYVKDGIRAAHLVMKYSQHTLLAGEGASAFAI 143

AT5G61540.3 7.96e-1278.05%
N-terminal nucleophile aminohydrolases ...
HSP 1
Score: 65.4698 bits (158), Expect = 7.96357e-12
Identity = 32/41 (78.05%), Postives = 37/41 (90.24%), Query Frame = 2
Query:   38 MEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
MEVGAVAAMRYVKDGIRAA LVM +++HT+L G+ ASAFAI
Sbjct: 1 MEVGAVAAMRYVKDGIRAAHLVMKYSQHTLLAGEGASAFAI 41

AT5G61540.2 7.96e-1278.05%
N-terminal nucleophile aminohydrolases ...
HSP 1
Score: 65.4698 bits (158), Expect = 7.96357e-12
Identity = 32/41 (78.05%), Postives = 37/41 (90.24%), Query Frame = 2
Query:   38 MEVGAVAAMRYVKDGIRAARLVMLHTEHTMLVGDHASAFAI 160
MEVGAVAAMRYVKDGIRAA LVM +++HT+L G+ ASAFAI
Sbjct: 1 MEVGAVAAMRYVKDGIRAAHLVMKYSQHTLLAGEGASAFAI 41

Related info for DR067363