CF810478

Information for CF810478

NameCF810478
AccessionID1700
Length593 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014530 cDNA cold acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CF810478
Sequence
GCAACCCCTACTTTGAGGCGAATAGAGAGGGCTGCAATAGCTGCCGCCACCCCTATTACT
TACCATTCCAGGGAACTTCTACTACTTATTCATGAACACCTTCAAGCATCTGGTTTGTCT
GCAACTGCGGACACACTTCTGAAAGAGGGTCAGTTAAATCCTTTGCCTTCTTCGGCAGCC
CCATCATCACTTGTGCATCAATCCTCAGTCCAGGACACACCAGCCATACAAATTCAATGG
CCATCTGGACATACTCCTGGCGGATTTCTCTCTGAGAGATCGAAAATCACTTCACGGGGT
GAAGTTTCTAGAGTGAAATGTGATTTAGATGTGGCTTCTGCAAAAAAGCCTCTGTCATTC
TCATCATCCTTTAATTCTCGGTCAAAAATTCAGCCTCTCTCACATGATTCCCCGCTGGCA
TCAAGTAGCAAAAGTAGCAATACTTCAAAAAAGTCTTCTGCACCCACAGGTCCTCCAGAA
ACACCCTCCATTTCTGCAGTGAAGGCCAACTTGGATAATGATGTGCAATTCAAAACTCCA
ATTGTGTTGCCAATGAAACGTAAATTAACAGAGTTAAAGGNACACTTGGGGGC
Download sequence in fasta format

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CF810478_1_ORF1 CRC64: 70AB61F0846F729E LENGTH: 198 aa
InterPro
IPR006594
Domain
LisH dimerisation motif
SM00667 [22-54]T 5.8e-05 SM00667 no description no description
PS50896 [22-54]T 10.087 PS50896 LISH LISH
InterPro
IPR013720
Domain
LisH dimerisation motif, subgroup
PF08513 [25-50]T 2.1e-05 PF08513 LisH LisH
noIPR
unintegrated
unintegrated
seg [4-20]? NA seg seg[54-64]? NA seg seg[119-128]? NA seg seg[134-153]? NA seg seg seg
SEQUENCE: CF810478_6_ORF1 CRC64: 88333DCF9CF4CC0F LENGTH: 67 aa
noIPR
unintegrated
unintegrated
seg [52-57]? NA seg seg seg

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CF810478
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0006s294602.06e-3043.35%POPTR_0006s29460.1
HSP 1
Score: 129.028 bits (323), Expect = 2.06163e-30
Identity = 75/173 (43.35%), Postives = 93/173 (53.76%), Query Frame = 1
Query:   61 YHSRELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQDTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASAKKPLXXXXXXXXXXKIQPLXXXXXXXXXXXXXXXXXXXXAPTGPPETPSISAVKANLDNDVQFKTPIVLPMKRKLTELK 579
YHSRELLLLIHEHLQASGL++ A LLKE QL HQ+S Q+TP+IQI WPSG TP GFL ++ K T + S +KC+ V+S KK L + Q A P E P S K+N + + KTPI+LPMKRKL++LK
Sbjct: 1021 YHSRELLLLIHEHLQASGLASAAAMLLKEAQLTPLPSLAAASSLSHQASTQETPSIQIHWPSGRTPCGFLYDKLKATGCSDNSSLKCEATVSSKKKSLVFSPTFGSQSRNQSQFIDSEQLPLKKVLSSLKQSTASPNPLEAPPESLQKSNPETESICKTPILLPMKRKLSDLK 1193

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CF810478
Best 10 Hits Shown

Match Name E value Identity Description
ppa021958m 1.56e-3247.13%ppa021958m
HSP 1
Score: 135.576 bits (340), Expect = 1.56113e-32
Identity = 82/174 (47.13%), Postives = 97/174 (55.75%), Query Frame = 1
Query:   61 YHSRELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQDTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVA-SAKKPLXXXXXXXXXXKIQPLXXXXXXXXXXXXXXXXXXXXAPTGPPETPSISAVKANLDNDVQFKTPIVLPMKRKLTELK 579
YHSRELLLLIHEHLQASGL+ATA +LLKE QL VHQ++ Q+ P++Q+QWPSG TP GFL+ +SKIT+R E VK D + S KKPL + Q A ETPS S K D + KTPIVLPMKRKL+ELK
Sbjct: 1060 YHSRELLLLIHEHLQASGLAATAASLLKEAQLMPLPSLAAPSSLVHQAT-QEAPSVQLQWPSGRTPSGFLTNKSKITARDEEPSVKFDSAFSYSKKKPLVFSPNFALQSRNQSQSHDSHWASARKVFGASKQFSATANASETPSASLPKPTFDTESPCKTPIVLPMKRKLSELK 1232

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CF810478
Best 10 Hits Shown

Match Name E value Identity Description
DCAF1_ARATH1.92e-1240.40%
DDB1- and CUL4-associated factor homolog...
HSP 1
Score: 72.4034 bits (176), Expect = 1.92199e-12
Identity = 40/99 (40.40%), Postives = 54/99 (54.55%), Query Frame = 1
Query:   61 YHSRELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQ-DTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASAKKPL 354
Y S+ELLLLIHEHLQASGL TA LLKE QL + ++ + TP Q QWPSG GF + + K+ + E + + +++ KK L
Sbjct: 1086 YDSKELLLLIHEHLQASGLGDTASALLKEAQLTPLPSSASPSSIAYSTTQEMSTPLAQEQWPSGRANSGFFTSKPKVCAHDEDPNSRSNAALSAKKKHL 1184

HSP 2
Score: 54.6842 bits (130), Expect = 4.14721e-07
Identity = 38/121 (31.40%), Postives = 49/121 (40.50%), Query Frame = 1
Query:  217 TPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASAKKPLXXXXXXXXXXKIQPLXXXXXXXXXXXXXXXXXXXXAPTGPPETPSISAVKANLDNDVQFKTPIVLPMKRKLTELK 579
TP Q QWPSG GF KI +R E + + ++ KK L + Q A ET + +K +LD D QFKTPI P KRKL+EL+
Sbjct: 1193 TPVAQQQWPSGRANCGFCPSIPKINARDEDPSSRGNAAPSAKKKQLTFSPSFSSQSRKQSFSHDALPQSTQRINCCSNSDPALADTSETAAELVLKNDLDADAQFKTPISFPRKRKLSELR 1313

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CF810478
Best 10 Hits Shown

Match Name E value Identity Description
D7SU71_VITVI1.55e-3549.43%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 152.91 bits (385), Expect = 1.55032e-35
Identity = 86/174 (49.43%), Postives = 103/174 (59.20%), Query Frame = 1
Query:   61 YHSRELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQDTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASA-KKPLXXXXXXXXXXKIQPLXXXXXXXXXXXXXXXXXXXXAPTGPPETPSISAVKANLDNDVQFKTPIVLPMKRKLTELK 579
YHSRELLLLIHEHLQASGLS TA LLKE QL VHQ+S Q+TP++Q+QWPSG GGFLS + K T++ E S + D V+S+ KKPL + QP AP PETPS++ K NLD + Q+KTPI+LPMKRKLTELK
Sbjct: 1069 YHSRELLLLIHEHLQASGLSTTAAQLLKEAQLTPLPSLAAPSSLVHQASSQETPSMQLQWPSGRIAGGFLSNKLKPTTKDEDSCLNSDSSVSSSKKKPLVFSSTLSFQFRNQPQSHDAQSPAISKVFSTSKKSSAPASVPETPSVTTSKPNLDAESQYKTPIILPMKRKLTELK 1242

B9SPT7_RICCO9.73e-3043.93%
Putative uncharacterized protein OS=Rici...
HSP 1
Score: 133.65 bits (335), Expect = 9.73312e-30
Identity = 76/173 (43.93%), Postives = 98/173 (56.65%), Query Frame = 1
Query:   61 YHSRELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQDTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASAKKPLXXXXXXXXXXKIQPLXXXXXXXXXXXXXXXXXXXXAPTGPPETPSISAVKANLDNDVQFKTPIVLPMKRKLTELK 579
YHSRELLLL+HEHLQASGL+ATA TLLKE QL +HQ++ Q+TP+ Q+QWPSG TP GF+ ++SK +R E S ++C+ ++S KKPL +IQ L A E + K N D + KTPIVLPMKRKL++LK
Sbjct: 1098 YHSRELLLLMHEHLQASGLAATAATLLKEAQLTPLPSLAAASSLMHQTTTQETPSTQLQWPSGRTPCGFMCKKSKAIARDEDSCLRCESALSSKKKPLVFSPTFNSQSRIQSLTLDSNQSSFKKASSGPKQSAAAGNLSEALPEALPKNNPDTESLCKTPIVLPMKRKLSDLK 1270

B9N6E4_POPTR2.40e-2843.35%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 129.028 bits (323), Expect = 2.39735e-28
Identity = 75/173 (43.35%), Postives = 93/173 (53.76%), Query Frame = 1
Query:   61 YHSRELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQDTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASAKKPLXXXXXXXXXXKIQPLXXXXXXXXXXXXXXXXXXXXAPTGPPETPSISAVKANLDNDVQFKTPIVLPMKRKLTELK 579
YHSRELLLLIHEHLQASGL++ A LLKE QL HQ+S Q+TP+IQI WPSG TP GFL ++ K T + S +KC+ V+S KK L + Q A P E P S K+N + + KTPI+LPMKRKL++LK
Sbjct: 1021 YHSRELLLLIHEHLQASGLASAAAMLLKEAQLTPLPSLAAASSLSHQASTQETPSIQIHWPSGRTPCGFLYDKLKATGCSDNSSLKCEATVSSKKKSLVFSPTFGSQSRNQSQFIDSEQLPLKKVLSSLKQSTASPNPLEAPPESLQKSNPETESICKTPILLPMKRKLSDLK 1193

A5B712_VITVI2.85e-1347.37%
Putative uncharacterized protein OS=Viti...
HSP 1
Score: 78.9518 bits (193), Expect = 2.84507e-13
Identity = 45/95 (47.37%), Postives = 58/95 (61.05%), Query Frame = 1
Query:   70 RELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQDTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASAKKPL 354
+ELLLLI EHLQASGLS TA LLKE QL V+ + Q+TP++Q+QWPSG GGFLS + K ++ S +K D + +KPL
Sbjct: 88 KELLLLIPEHLQASGLSTTAARLLKEAQLTPWTSLAASSSLVYPAFSQETPSMQLQWPSGRIAGGFLSNKLKPPTKDRGSCLKSDSSM--TEKPL 180

D7MB91_ARALY3.72e-1342.42%
Transducin family protein OS=Arabidopsis...
HSP 1
Score: 78.5666 bits (192), Expect = 3.71578e-13
Identity = 42/99 (42.42%), Postives = 55/99 (55.56%), Query Frame = 1
Query:   61 YHSRELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQ-DTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASAKKPL 354
Y S+ELLLLIHEHLQASGL TA LLKE QL + S+ + TP Q QWPSG GF + + K+ + E +C+ +++ KK L
Sbjct: 1055 YDSKELLLLIHEHLQASGLGETASALLKEAQLTPLPSLASPSSIAYSSTQEMSTPLAQEQWPSGRANSGFFTSKPKVCAHDEDPNSRCNAAISAKKKHL 1153

Q7XKA7_ORYSJ2.25e-1032.18%
OSJNBb0020J19.2 protein OS=Oryza sativa ...
HSP 1
Score: 69.3218 bits (168), Expect = 2.25429e-10
Identity = 56/174 (32.18%), Postives = 78/174 (44.83%), Query Frame = 1
Query:   61 YHSRELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQDTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASAKKPLXXXXXXXXXXKIQPLXXXXXXXXXXXXXXXXXXXXAPTGPPETPSISAVKANL-DNDVQFKTPIVLPMKRKLTELK 579
YHSREL+ LIHEHL SG +ATA L KE L VHQ + +T + Q QWPSG GF+ + +K+T+ + + + D + S+KK + QP P G + +A N D + KTP+ LP KRKL ++K
Sbjct: 1167 YHSRELMQLIHEHLLGSGFTATAAMLQKEADL-APLPSTAAVTPVHQVAALETSSAQQQWPSGRVQ-GFVPDTTKVTT--DQTGQRSDSVLPSSKKK-SLSFSSSFSKRTQP-----SHLFSGNRASNSLKSPVPIGNVDNMICAASTVNTGDAETSHKTPLSLPQKRKLVDMK 1330

Q259V1_ORYSA2.25e-1032.18%
B0518A01.3 protein OS=Oryza sativa GN=B0...
HSP 1
Score: 69.3218 bits (168), Expect = 2.25429e-10
Identity = 56/174 (32.18%), Postives = 78/174 (44.83%), Query Frame = 1
Query:   61 YHSRELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQDTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASAKKPLXXXXXXXXXXKIQPLXXXXXXXXXXXXXXXXXXXXAPTGPPETPSISAVKANL-DNDVQFKTPIVLPMKRKLTELK 579
YHSREL+ LIHEHL SG +ATA L KE L VHQ + +T + Q QWPSG GF+ + +K+T+ + + + D + S+KK + QP P G + +A N D + KTP+ LP KRKL ++K
Sbjct: 1166 YHSRELMQLIHEHLLGSGFTATAAMLQKEADL-APLPSTAAVTPVHQVAALETSSAQQQWPSGRVQ-GFVPDTTKVTT--DQTGQRSDSVLPSSKKK-SLSFSSSFSKRTQP-----SYLFSGNRASNSLKSPVPIGNVDNMICAASTVNTGDAETSHKTPLSLPQKRKLVDMK 1329

A3AYX5_ORYSJ2.25e-1032.18%
Putative uncharacterized protein OS=Oryz...
HSP 1
Score: 69.3218 bits (168), Expect = 2.25429e-10
Identity = 56/174 (32.18%), Postives = 78/174 (44.83%), Query Frame = 1
Query:   61 YHSRELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQDTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASAKKPLXXXXXXXXXXKIQPLXXXXXXXXXXXXXXXXXXXXAPTGPPETPSISAVKANL-DNDVQFKTPIVLPMKRKLTELK 579
YHSREL+ LIHEHL SG +ATA L KE L VHQ + +T + Q QWPSG GF+ + +K+T+ + + + D + S+KK + QP P G + +A N D + KTP+ LP KRKL ++K
Sbjct: 1167 YHSRELMQLIHEHLLGSGFTATAAMLQKEADL-APLPSTAAVTPVHQVAALETSSAQQQWPSGRVQ-GFVPDTTKVTT--DQTGQRSDSVLPSSKKK-SLSFSSSFSKRTQP-----SHLFSGNRASNSLKSPVPIGNVDNMICAASTVNTGDAETSHKTPLSLPQKRKLVDMK 1330

A2XZA0_ORYSI2.25e-1032.18%
Putative uncharacterized protein OS=Oryz...
HSP 1
Score: 69.3218 bits (168), Expect = 2.25429e-10
Identity = 56/174 (32.18%), Postives = 78/174 (44.83%), Query Frame = 1
Query:   61 YHSRELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQDTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASAKKPLXXXXXXXXXXKIQPLXXXXXXXXXXXXXXXXXXXXAPTGPPETPSISAVKANL-DNDVQFKTPIVLPMKRKLTELK 579
YHSREL+ LIHEHL SG +ATA L KE L VHQ + +T + Q QWPSG GF+ + +K+T+ + + + D + S+KK + QP P G + +A N D + KTP+ LP KRKL ++K
Sbjct: 1086 YHSRELMQLIHEHLLGSGFTATAAMLQKEADL-APLPSTAAVTPVHQVAALETSSAQQQWPSGRVQ-GFVPDTTKVTT--DQTGQRSDSVLPSSKKK-SLSFSSSFSKRTQP-----SHLFSGNRASNSLKSPVPIGNVDNMICAASTVNTGDAETSHKTPLSLPQKRKLVDMK 1249

C5YB39_SORBI1.24e-0831.21%
Putative uncharacterized protein Sb06g03...
HSP 1
Score: 63.5438 bits (153), Expect = 1.23697e-08
Identity = 54/173 (31.21%), Postives = 73/173 (42.20%), Query Frame = 1
Query:   61 YHSRELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQDTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASAKKPLXXXXXXXXXXKIQPLXXXXXXXXXXXXXXXXXXXXAPTGPPETPSISAVKANLDNDVQFKTPIVLPMKRKLTELK 579
YHSREL+ LIHEHL SG +ATA L KE L HQ + + ++Q QWPSG GFLS+ KI + S + D + S+KK + P + P I D ++ KTP+ LP+KRKL ++K
Sbjct: 1169 YHSRELMQLIHEHLLGSGFTATAAMLQKEAGL-APLPLTAAVLPAHQVAALEASSVQQQWPSGRVQ-GFLSD--KINMSTDQSAQRSDSILPSSKKKALTFSSSFSRRALSP----------HPISGSRASNILKSPVPIAADIG------DAEMLNKTPLSLPLKRKLVDVK 1321

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CF810478
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010355870018.20e-3849.43%GSVIVT01035587001 assembled CDS
HSP 1
Score: 152.91 bits (385), Expect = 8.19552e-38
Identity = 86/174 (49.43%), Postives = 103/174 (59.20%), Query Frame = 1
Query:   61 YHSRELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQDTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASA-KKPLXXXXXXXXXXKIQPLXXXXXXXXXXXXXXXXXXXXAPTGPPETPSISAVKANLDNDVQFKTPIVLPMKRKLTELK 579
YHSRELLLLIHEHLQASGLS TA LLKE QL VHQ+S Q+TP++Q+QWPSG GGFLS + K T++ E S + D V+S+ KKPL + QP AP PETPS++ K NLD + Q+KTPI+LPMKRKLTELK
Sbjct: 1069 YHSRELLLLIHEHLQASGLSTTAAQLLKEAQLTPLPSLAAPSSLVHQASSQETPSMQLQWPSGRIAGGFLSNKLKPTTKDEDSCLNSDSSVSSSKKKPLVFSSTLSFQFRNQPQSHDAQSPAISKVFSTSKKSSAPASVPETPSVTTSKPNLDAESQYKTPIILPMKRKLTELK 1242

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CF810478
Best 10 Hits Shown

Match Name E value Identity Description
AT4G31160.1 2.02e-1340.40%
DDB1-CUL4 associated factor 1 | chr4:15...
HSP 1
Score: 72.4034 bits (176), Expect = 2.01802e-13
Identity = 40/99 (40.40%), Postives = 54/99 (54.55%), Query Frame = 1
Query:   61 YHSRELLLLIHEHLQASGLSATADTLLKEGQLNXXXXXXXXXXXVHQSSVQ-DTPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASAKKPL 354
Y S+ELLLLIHEHLQASGL TA LLKE QL + ++ + TP Q QWPSG GF + + K+ + E + + +++ KK L
Sbjct: 1086 YDSKELLLLIHEHLQASGLGDTASALLKEAQLTPLPSSASPSSIAYSTTQEMSTPLAQEQWPSGRANSGFFTSKPKVCAHDEDPNSRSNAALSAKKKHL 1184

HSP 2
Score: 54.6842 bits (130), Expect = 4.35443e-08
Identity = 38/121 (31.40%), Postives = 49/121 (40.50%), Query Frame = 1
Query:  217 TPAIQIQWPSGHTPGGFLSERSKITSRGEVSRVKCDLDVASAKKPLXXXXXXXXXXKIQPLXXXXXXXXXXXXXXXXXXXXAPTGPPETPSISAVKANLDNDVQFKTPIVLPMKRKLTELK 579
TP Q QWPSG GF KI +R E + + ++ KK L + Q A ET + +K +LD D QFKTPI P KRKL+EL+
Sbjct: 1193 TPVAQQQWPSGRANCGFCPSIPKINARDEDPSSRGNAAPSAKKKQLTFSPSFSSQSRKQSFSHDALPQSTQRINCCSNSDPALADTSETAAELVLKNDLDADAQFKTPISFPRKRKLSELR 1313

Related info for CF810478