Please Note: This site will be unavailable Thursday May 1st  due to maintenance and content upgrades. We apologize for the inconvenience. 

CF810751

Information for CF810751

NameCF810751
AccessionID1721
Length627 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014530 cDNA cold acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CF810751
Sequence
AAGATGCGATACATTCCAAGACTGCATAACCTGGGCTCGGATGAAGTTTGAAGATTATTT
TGCCAACCGGGTGAAGCAGTTGGCTTTTACTTTCCCAGAGGATGCTGCAACCAGTACCGG
GGCTCCATTTTGGTCAGCCCCTAAGCGTTTCCCCCGCCCATTGCAATTCTCCACTGCTGA
TCCTAGCCACCTCCATTTCCTCATGGCAGCGTCGATACTACGAGCGGAGACATTTGGCAT
TCCAATTCCTGATTGGGTCAAGAGCCCTAGTAAGTTGGCTGAAGCTGTGGACAGAGTGAT
GGTTCCCGAGTTTCAACCCAAGAAAGACGTGAAGATTGTGACTGATGAAAAGGCTACCAG
TCTGTCCACTGCTTCTATAGATGATGCAGCAGTCATCAATGAACTACTCGTGAAACTAGA
AACAGTGCCGTGCTAATCTGCAACCTGGCTTCCGGATGAAACCAATTCAGTTTGAGAAGG
ATGATGATACGAATTACCACATGGACATGATAGCTGGTCTAGCTAACATGAGGGCGAGAA
ACTACAGTATTCCTGAAGTTGACAAGCTGAAGGCCAAATTCATTGCTGGAAGGATCATCC
CAGCCATAGCAACCTCCACGGCAATGG
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0006464 biological_process protein modification process
GO:0005524 molecular_function ATP binding
GO:0008641 molecular_function small protein activating enzyme activity

KEGG Analysis

Analysis Date: 01-18-2011 (KEGG analysis for Vaccinium corymbosum unigene v1)
K03178 UBE1, UBA1; ubiquitin-activating enzyme E1 [EC:6.3.2.19]

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CF810751_2_ORF1 CRC64: 5AEE1C20AFE397C7 LENGTH: 144 aa
InterPro
IPR000127
Repeat
Ubiquitin-activating enzyme repeat
PF02134 [56-109]T 5.1e-07 PF02134 UBACT UBACT
InterPro
IPR009036
Domain
Molybdenum cofactor biosynthesis, MoeB
SSF69572 [1-116]T 1.3e-14 SSF69572 Activating enzymes of the ubiquitin-like proteins Activating enzymes of the ubiquitin-like proteins
noIPR
unintegrated
unintegrated
G3DSA:1.10.3240.10 [3-121]T 7.4e-15 G3DSA:1.10.3240.10 no description no description
PTHR10953 [1-29]T 2.2e-11 PTHR10953 UBIQUITIN-ACTIVATING ENZYME E1 UBIQUITIN-ACTIVATING ENZYME E1
PTHR10953:SF4 [1-29]T 2.2e-11 PTHR10953:SF4 UBIQUITIN-ACTIVATING ENZYME E1 UBIQUITIN-ACTIVATING ENZYME E1
SEQUENCE: CF810751_3_ORF3 CRC64: 73C317B1C71F9EBD LENGTH: 69 aa
InterPro
IPR000127
Repeat
Ubiquitin-activating enzyme repeat
PF02134 [17-69]T 1.2e-18 PF02134 UBACT UBACT
InterPro
IPR009036
Domain
Molybdenum cofactor biosynthesis, MoeB
SSF69572 [11-69]T 1.1e-11 SSF69572 Activating enzymes of the ubiquitin-like proteins Activating enzymes of the ubiquitin-like proteins
noIPR
unintegrated
unintegrated
G3DSA:1.10.3240.10 [3-58]T 6.7e-15 G3DSA:1.10.3240.10 no description no description

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CF810751
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0001s287501.20e-9680.71%POPTR_0001s28750.1
HSP 1
Score: 244.973 bits (624), Expect = 1.19912e-96
Identity = 113/140 (80.71%), Postives = 131/140 (93.57%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLE 421
+C+TFQDCITWAR++FEDYFA+RVKQL FTFPEDA+TSTGAPFWSAPKRFP PLQFSTADPSHLHF+MAASILRAETFGI +P+WVK P LAEAV++V+VPEFQP++DVKI TDEKAT++ST S+DDAAVINEL+ KLE
Sbjct: 731 KCETFQDCITWARLRFEDYFADRVKQLIFTFPEDASTSTGAPFWSAPKRFPHPLQFSTADPSHLHFVMAASILRAETFGISVPEWVKHPKTLAEAVEKVIVPEFQPREDVKIETDEKATTISTVSVDDAAVINELIRKLE 870

HSP 2
Score: 126.716 bits (317), Expect = 1.19912e-96
Identity = 61/69 (88.41%), Postives = 64/69 (92.75%), Query Frame = 3
Query:  420 KQCRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
+QCR L P +RM PIQFEKDDDTNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 870 EQCRHKLPPAYRMTPIQFEKDDDTNYHMDLIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 938

POPTR_0009s079604.96e-9578.57%POPTR_0009s07960.1
HSP 1
Score: 239.58 bits (610), Expect = 4.95875e-95
Identity = 110/140 (78.57%), Postives = 128/140 (91.43%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLE 421
+C+TFQDCITWAR++FEDYFA+RVKQL FTFPEDA+TSTGAPFWSAPKRFP PLQFS DPSHLHF+MAASILRAETFGI +P+W K P LAEAV++V+VPEFQP++D KI TDEKAT+LS+AS+DDAAVINEL+ KLE
Sbjct: 728 KCETFQDCITWARLRFEDYFADRVKQLIFTFPEDASTSTGAPFWSAPKRFPHPLQFSVVDPSHLHFVMAASILRAETFGISVPEWAKHPKMLAEAVEKVVVPEFQPREDAKIETDEKATTLSSASVDDAAVINELIKKLE 867

HSP 2
Score: 126.716 bits (317), Expect = 4.95875e-95
Identity = 62/69 (89.86%), Postives = 64/69 (92.75%), Query Frame = 3
Query:  420 KQCRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
+QCR L GFRM PIQFEKDDDTNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 867 EQCRQKLPLGFRMTPIQFEKDDDTNYHMDLIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 935

POPTR_0009s079505.43e-9474.29%POPTR_0009s07950.1
HSP 1
Score: 233.032 bits (593), Expect = 5.42594e-94
Identity = 104/140 (74.29%), Postives = 128/140 (91.43%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLE 421
+C+T QDCI+WAR+KFEDYF++RVKQL +TFPEDA+TSTG PFWSAPKRFP PLQFST D SHLHF+MAAS+LRAETFGIP+PDW+++P +AEAVD+V+VP+FQP++ VKI TDEKAT+LS AS+DDAA+INEL+ KLE
Sbjct: 738 KCETLQDCISWARLKFEDYFSDRVKQLIYTFPEDASTSTGVPFWSAPKRFPHPLQFSTTDLSHLHFVMAASVLRAETFGIPVPDWIRNPKMVAEAVDKVIVPDFQPREGVKIETDEKATNLSNASVDDAAIINELIRKLE 877

HSP 2
Score: 129.798 bits (325), Expect = 5.42594e-94
Identity = 63/67 (94.03%), Postives = 64/67 (95.52%), Query Frame = 3
Query:  426 CRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
CR NL GFRMKPIQFEKDDDTNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 879 CRENLPAGFRMKPIQFEKDDDTNYHMDLIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 945

POPTR_0009s079609.18e-6778.57%POPTR_0009s07960.2
HSP 1
Score: 239.58 bits (610), Expect = 9.17779e-67
Identity = 110/140 (78.57%), Postives = 128/140 (91.43%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLE 421
+C+TFQDCITWAR++FEDYFA+RVKQL FTFPEDA+TSTGAPFWSAPKRFP PLQFS DPSHLHF+MAASILRAETFGI +P+W K P LAEAV++V+VPEFQP++D KI TDEKAT+LS+AS+DDAAVINEL+ KLE
Sbjct: 728 KCETFQDCITWARLRFEDYFADRVKQLIFTFPEDASTSTGAPFWSAPKRFPHPLQFSVVDPSHLHFVMAASILRAETFGISVPEWAKHPKMLAEAVEKVVVPEFQPREDAKIETDEKATTLSSASVDDAAVINELIKKLE 867

HSP 2
Score: 32.3426 bits (72), Expect = 9.17779e-67
Identity = 14/20 (70.00%), Postives = 15/20 (75.00%), Query Frame = 3
Query:  420 KQCRANLQPGFRMKPIQFEK 479
+QCR L GFRM PIQFEK
Sbjct: 867 EQCRQKLPLGFRMTPIQFEK 886

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CF810751
Best 10 Hits Shown

Match Name E value Identity Description
ppa000549m 2.28e-9476.43%ppa000549m
HSP 1
Score: 233.802 bits (595), Expect = 2.28356e-94
Identity = 107/140 (76.43%), Postives = 126/140 (90.00%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLE 421
RC+TFQDCI WAR+KFEDYF+NRVKQL +TFPEDA TSTGAPFWSAPKRFP PLQFS ADP HLHF++AA+ILRAETFGIPIPDWV++ K+AEAV++V V EFQPKKD KIVTD++AT+L+ S+DDA VINEL++KLE
Sbjct: 745 RCETFQDCIGWARLKFEDYFSNRVKQLIYTFPEDATTSTGAPFWSAPKRFPHPLQFSAADPGHLHFVIAAAILRAETFGIPIPDWVRNTKKVAEAVEKVEVSEFQPKKDAKIVTDDEATNLTPQSLDDAQVINELIIKLE 884

HSP 2
Score: 129.798 bits (325), Expect = 2.28356e-94
Identity = 62/69 (89.86%), Postives = 65/69 (94.20%), Query Frame = 3
Query:  420 KQCRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
+ CR L PGFRMKPIQFEKDDDTNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIAT+TAM
Sbjct: 884 EHCREKLPPGFRMKPIQFEKDDDTNYHMDLIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATTTAM 952

ppa000563m 1.76e-9178.57%ppa000563m
HSP 1
Score: 233.802 bits (595), Expect = 1.75733e-91
Identity = 110/140 (78.57%), Postives = 125/140 (89.29%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLE 421
RC+TFQDCI+WAR+KFEDYF NRVKQL +TFPEDA TS+G PFWSAPKRFPRPLQFS D SHL F+M ASILRAETF IPIPDWVKS +K A+AV++V+VP+FQPKKDVKIVTDEKAT++ ASIDDA VINEL+VKLE
Sbjct: 739 RCETFQDCISWARLKFEDYFVNRVKQLTYTFPEDAKTSSGTPFWSAPKRFPRPLQFSVDDLSHLQFIMGASILRAETFNIPIPDWVKSHTKFADAVNKVIVPDFQPKKDVKIVTDEKATNVLPASIDDAVVINELIVKLE 878

HSP 2
Score: 120.168 bits (300), Expect = 1.75733e-91
Identity = 56/69 (81.16%), Postives = 62/69 (89.86%), Query Frame = 3
Query:  420 KQCRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
++C+ L P F+M PIQFEKDDDTNYHMD+IAG ANMRARNY IPEVDKLKAKFIAGRIIPAIATSTA+
Sbjct: 878 EKCKEQLPPAFKMNPIQFEKDDDTNYHMDVIAGFANMRARNYGIPEVDKLKAKFIAGRIIPAIATSTAL 946

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CF810751
Best 10 Hits Shown

Match Name E value Identity Description
UBE12_WHEAT1.61e-8775.52%
Ubiquitin-activating enzyme E1 2 OS=Trit...
HSP 1
Score: 229.18 bits (583), Expect = 1.6088e-87
Identity = 108/143 (75.52%), Postives = 131/143 (91.61%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKL-AEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLETV 427
+C+TFQD ITWAR+KFEDYF+NRVKQL FTFPED+ TS+GAPFWSAPKRFPRP++FS++DPS L F++AA+ILRAETFGIPI +W K+P+KL AEAVD+V+VP+FQPK+ VKIVTDEKATSLS+AS+DDAAVI EL+ KLE V
Sbjct: 694 KCETFQDSITWARLKFEDYFSNRVKQLTFTFPEDSMTSSGAPFWSAPKRFPRPVEFSSSDPSQLSFILAAAILRAETFGIPISEWAKTPNKLAAEAVDKVIVPDFQPKQGVKIVTDEKATSLSSASVDDAAVIEELIAKLEEV 836

HSP 2
Score: 115.161 bits (287), Expect = 1.6088e-87
Identity = 56/63 (88.89%), Postives = 58/63 (92.06%), Query Frame = 3
Query:  438 LQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
L GF M PIQFEKDDDTN+HMD+IAG ANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 840 LPSGFHMNPIQFEKDDDTNFHMDVIAGFANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 902

UBE11_WHEAT1.03e-8674.83%
Ubiquitin-activating enzyme E1 1 OS=Trit...
HSP 1
Score: 226.483 bits (576), Expect = 1.03388e-86
Identity = 107/143 (74.83%), Postives = 130/143 (90.91%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKL-AEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLETV 427
+C+TFQD ITWAR+KFEDYF+NRVKQL FTFPED+ TS+GAPFWSAPKRFPRP++FS++D S L F++AA+ILRAETFGIPIP+W K+P+KL AEAVD+V+VP+FQPK+ VKIVT EKATSLS+AS+DDAAVI EL+ KLE V
Sbjct: 694 KCETFQDSITWARLKFEDYFSNRVKQLTFTFPEDSMTSSGAPFWSAPKRFPRPVEFSSSDQSQLSFILAAAILRAETFGIPIPEWAKTPNKLAAEAVDKVIVPDFQPKQGVKIVTHEKATSLSSASVDDAAVIEELIAKLEEV 836

HSP 2
Score: 115.161 bits (287), Expect = 1.03388e-86
Identity = 56/63 (88.89%), Postives = 58/63 (92.06%), Query Frame = 3
Query:  438 LQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
L GF M PIQFEKDDDTN+HMD+IAG ANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 840 LPSGFHMNPIQFEKDDDTNFHMDVIAGFANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 902

UBE13_WHEAT2.51e-8570.71%
Ubiquitin-activating enzyme E1 3 OS=Trit...
HSP 1
Score: 216.083 bits (549), Expect = 2.5089e-85
Identity = 99/140 (70.71%), Postives = 120/140 (85.71%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLE 421
RC TF DCI+WAR+KFEDYF+NRVKQL FTFPEDAATS GAPFWSAPKRFPR LQFS AD SHL+F+M+ASILRAE+FG+ IP+W K SKLA+ V+++ VP F+PK+ V IVTDEKA++LS+ S+DD AVI +LL KL+
Sbjct: 697 RCSTFDDCISWARLKFEDYFSNRVKQLTFTFPEDAATSMGAPFWSAPKRFPRALQFSAADQSHLNFIMSASILRAESFGVAIPEWAKDTSKLADVVNKIAVPTFEPKQGVNIVTDEKASNLSSTSVDDVAVIEDLLAKLQ 836

HSP 2
Score: 120.939 bits (302), Expect = 2.5089e-85
Identity = 58/63 (92.06%), Postives = 62/63 (98.41%), Query Frame = 3
Query:  438 LQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
L PGF+MKPIQFEKDDDTN+HMD+I+GLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 842 LLPGFQMKPIQFEKDDDTNFHMDLISGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 904

UBA1_BOVIN2.21e-4340.31%
Ubiquitin-like modifier-activating enzym...
HSP 1
Score: 107.457 bits (267), Expect = 2.20904e-43
Identity = 52/129 (40.31%), Postives = 78/129 (60.47%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDA 388
R T+ DC+TWA + ++N ++QL FP D TS+GAPFWS PKR P PL F ++P HL +++AA+ L A+T+G+ + + +A + V VPEF PK VKI ++ + AS+DD+
Sbjct: 699 RPQTWADCVTWACHHWHTQYSNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVSNPLHLDYVIAAANLFAQTYGL---TGSQDRAAVATLLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDS 824

HSP 2
Score: 89.3521 bits (220), Expect = 2.20904e-43
Identity = 40/60 (66.67%), Postives = 48/60 (80.00%), Query Frame = 3
Query:  444 PGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTA 623
PGF+M PI FEKDDDTN+HMD I +N+RA NY IP D+ K+K IAG+IIPAIAT+TA
Sbjct: 840 PGFKMYPIDFEKDDDTNFHMDFIVAASNLRAENYDIPPADRHKSKLIAGKIIPAIATTTA 899

UBA1_HUMAN4.89e-4341.09%
Ubiquitin-like modifier-activating enzym...
HSP 1
Score: 107.457 bits (267), Expect = 4.88738e-43
Identity = 53/129 (41.09%), Postives = 77/129 (59.69%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDA 388
R T+ DC+TWA + ++N ++QL FP D TS+GAPFWS PKR P PL F +P HL ++MAA+ L A+T+G+ + + +A + V VPEF PK VKI ++ + AS+DD+
Sbjct: 699 RPQTWADCVTWACHHWHTQYSNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGL---TGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDS 824

HSP 2
Score: 88.1965 bits (217), Expect = 4.88738e-43
Identity = 39/60 (65.00%), Postives = 48/60 (80.00%), Query Frame = 3
Query:  444 PGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTA 623
PGF+M PI FEKDDD+N+HMD I +N+RA NY IP D+ K+K IAG+IIPAIAT+TA
Sbjct: 840 PGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAGKIIPAIATTTA 899

UBA1_RABIT1.08e-4240.48%
Ubiquitin-like modifier-activating enzym...
HSP 1
Score: 106.686 bits (265), Expect = 1.08126e-42
Identity = 51/126 (40.48%), Postives = 77/126 (61.11%), Query Frame = 2
Query:   11 TFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDA 388
++ DC+TWA + ++N ++QL FP D TS+GAPFWS PKR P PL F ++P HL ++MAA+ L A+T+G+ + + +A + V VPEF PK VKI ++ + AS+DD+
Sbjct: 702 SWADCVTWACHHWHTQYSNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVSNPLHLDYVMAAANLFAQTYGLA---GSQDRAAVATLLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDS 824

HSP 2
Score: 87.8113 bits (216), Expect = 1.08126e-42
Identity = 39/60 (65.00%), Postives = 48/60 (80.00%), Query Frame = 3
Query:  444 PGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTA 623
PGF+M PI FEKDDD+N+HMD I +N+RA NY IP D+ K+K IAG+IIPAIAT+TA
Sbjct: 840 PGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPPADRHKSKLIAGKIIPAIATTTA 899

UBA1_DICDI3.37e-4147.90%
Ubiquitin-like modifier-activating enzym...
HSP 1
Score: 113.235 bits (282), Expect = 3.37453e-41
Identity = 57/119 (47.90%), Postives = 76/119 (63.87%), Query Frame = 2
Query:   14 FQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLST 370
F CI WAR+KFE+YF N ++QL + FP+D T+TG PFWS PKR P PL+F +P HL F++AA+ LRA +GI ++ K A V+VP+F PKK VKI T E + S+
Sbjct: 662 FNQCIAWARLKFEEYFNNNIEQLLYNFPKDMVTTTGTPFWSGPKRAPTPLKFDVENPLHLEFIVAAANLRAFNYGIKAETNIEVIQKQAA---NVIVPDFTPKK-VKIQTSENEPAPSS 776

HSP 2
Score: 76.2554 bits (186), Expect = 3.37453e-41
Identity = 34/60 (56.67%), Postives = 46/60 (76.67%), Query Frame = 3
Query:  447 GFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
G+++ IQFEKDDDTN+H+D I +N+RA NY+I DK K K IAG+IIPA+ T+TA+
Sbjct: 805 GYKINSIQFEKDDDTNHHIDFITATSNLRATNYAISPADKHKTKGIAGKIIPALVTTTAV 864

UBA1_RAT4.39e-4140.31%
Ubiquitin-like modifier-activating enzym...
HSP 1
Score: 104.375 bits (259), Expect = 4.39496e-41
Identity = 52/129 (40.31%), Postives = 75/129 (58.14%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDA 388
R T+ DC+TWA + + N ++QL FP D TS+GAPFWS PKR P PL F + HL ++MAA+ L A+T+G+ + + +A + V VPEF PK VKI ++ + AS+DD+
Sbjct: 699 RPQTWGDCVTWACHHWHTQYCNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNTLHLDYVMAAANLFAQTYGL---TGSQDRAAVASLLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDS 824

HSP 2
Score: 84.7297 bits (208), Expect = 4.39496e-41
Identity = 38/60 (63.33%), Postives = 47/60 (78.33%), Query Frame = 3
Query:  444 PGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTA 623
PGF+M PI FEKDDD+N+HMD I +N+RA NY I D+ K+K IAG+IIPAIAT+TA
Sbjct: 840 PGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDISPADRHKSKLIAGKIIPAIATTTA 899

UBA1_MOUSE4.39e-4140.31%
Ubiquitin-like modifier-activating enzym...
HSP 1
Score: 104.375 bits (259), Expect = 4.39496e-41
Identity = 52/129 (40.31%), Postives = 75/129 (58.14%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDA 388
R T+ DC+TWA + + N ++QL FP D TS+GAPFWS PKR P PL F + HL ++MAA+ L A+T+G+ + + +A + V VPEF PK VKI ++ + AS+DD+
Sbjct: 699 RPQTWGDCVTWACHHWHTQYCNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNTLHLDYVMAAANLFAQTYGL---TGSQDRAAVASLLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDS 824

HSP 2
Score: 84.7297 bits (208), Expect = 4.39496e-41
Identity = 38/60 (63.33%), Postives = 47/60 (78.33%), Query Frame = 3
Query:  444 PGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTA 623
PGF+M PI FEKDDD+N+HMD I +N+RA NY I D+ K+K IAG+IIPAIAT+TA
Sbjct: 840 PGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDISPADRHKSKLIAGKIIPAIATTTA 899

UBA1_YEAST4.40e-4137.96%
Ubiquitin-activating enzyme E1 1 OS=Sacc...
HSP 1
Score: 107.842 bits (268), Expect = 4.39641e-41
Identity = 52/137 (37.96%), Postives = 81/137 (59.12%), Query Frame = 2
Query:   14 FQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPS--KLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKL 418
F+DCI WAR++FE F + +KQL F FP+DA TS G PFWS KR P PL+F + H HF++A + LRA +GI D P+ + +D +++PEF P ++KI ++ + + + + I++L+ L
Sbjct: 669 FEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDIYNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVNDDDPDPNANAANGSDEIDQLVSSL 805

HSP 2
Score: 81.2629 bits (199), Expect = 4.39641e-41
Identity = 35/60 (58.33%), Postives = 48/60 (80.00%), Query Frame = 3
Query:  447 GFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
GF+++P+ FEKDDDTN+H++ I +N RA+NY I D+ K KFIAGRIIPAIAT+T++
Sbjct: 813 GFKLEPVDFEKDDDTNHHIEFITACSNCRAQNYFIETADRQKTKFIAGRIIPAIATTTSL 872

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CF810751
Best 10 Hits Shown

Match Name E value Identity Description
D7SJT2_VITVI2.07e-9685.71%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 253.447 bits (646), Expect = 2.07169e-96
Identity = 120/140 (85.71%), Postives = 129/140 (92.14%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLE 421
RC+TFQDCITWAR++FEDYF NRVKQL FTFPEDAATSTGAPFWSAPKRFP PLQFS AD HL+F+MAASILRAETFGIPIPDW K P KLAEAVD+V+VPEFQPK DVKIVTDEKATSLSTAS+DDAAVINELL K+E
Sbjct: 690 RCETFQDCITWARLRFEDYFVNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSAADAGHLYFVMAASILRAETFGIPIPDWAKHPKKLAEAVDKVIVPEFQPKTDVKIVTDEKATSLSTASVDDAAVINELLAKIE 829

HSP 2
Score: 124.405 bits (311), Expect = 2.07169e-96
Identity = 61/69 (88.41%), Postives = 64/69 (92.75%), Query Frame = 3
Query:  420 KQCRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
+Q +L PGFRM PIQFEKDDDTNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 829 EQSWKSLPPGFRMNPIQFEKDDDTNYHMDLIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 897

D7SQU6_VITVI1.02e-9585.00%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 252.677 bits (644), Expect = 1.02128e-95
Identity = 119/140 (85.00%), Postives = 130/140 (92.86%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLE 421
RC+TFQDCITWAR+KFEDYFANRVKQL FTFPEDAATS GAPFWSAPKRFPRPLQFS DP LHF+MAAS+LRAETFGIPIPDWVKSP K A+AV +V+VP+F PKKDVKIVTDEKATSLSTAS+DDAAVINEL++KLE
Sbjct: 662 RCETFQDCITWARLKFEDYFANRVKQLTFTFPEDAATSNGAPFWSAPKRFPRPLQFSIDDPGQLHFVMAASVLRAETFGIPIPDWVKSPMKFADAVSKVIVPDFLPKKDVKIVTDEKATSLSTASVDDAAVINELIMKLE 801

HSP 2
Score: 122.865 bits (307), Expect = 1.02128e-95
Identity = 58/69 (84.06%), Postives = 64/69 (92.75%), Query Frame = 3
Query:  420 KQCRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
++C+ L PGFRM PIQFEKDDD+NYHMD+I+ LANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 801 EKCQKKLPPGFRMNPIQFEKDDDSNYHMDLISALANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 869

Q75VJ8_TOBAC5.03e-9584.40%
Ubiquitin-activating enzyme E1 OS=Nicoti...
HSP 1
Score: 249.98 bits (637), Expect = 5.0345e-95
Identity = 119/141 (84.40%), Postives = 132/141 (93.62%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLET 424
RCDTFQDCITWAR++FEDYFA+RVKQL FTFPE+A TS+GAPFWSAPKRFPRPLQFS D SHL FL+AASILRAETFGI IPDWVKSP KLAEAVD+V+VP+FQPKKDVKIVTDEKATS++ +SIDDAAVINEL+VKLET
Sbjct: 724 RCDTFQDCITWARLRFEDYFADRVKQLTFTFPEEATTSSGAPFWSAPKRFPRPLQFSVDDASHLQFLLAASILRAETFGILIPDWVKSPQKLAEAVDKVIVPDFQPKKDVKIVTDEKATSMAASSIDDAAVINELVVKLET 864

HSP 2
Score: 123.25 bits (308), Expect = 5.0345e-95
Identity = 59/67 (88.06%), Postives = 62/67 (92.54%), Query Frame = 3
Query:  426 CRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
CR L G++M PIQFEKDDDTNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 865 CRQELPSGYKMNPIQFEKDDDTNYHMDLIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 931

P93393_TOBAC1.12e-9483.69%
Ubiquitin-activating enzyme E1 OS=Nicoti...
HSP 1
Score: 248.825 bits (634), Expect = 1.11781e-94
Identity = 118/141 (83.69%), Postives = 132/141 (93.62%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLET 424
RCDTFQDCITWAR++FEDYFA+RVKQL FTFPE+A TS+GAPFWSAPKRFPRPLQFS D SHL FL+AASILRAETFGI IPDWVKSP KLAEAVD+V+VP+FQPKKDVKIVTDEKATS++ +SIDDAAVINEL++KLET
Sbjct: 724 RCDTFQDCITWARLRFEDYFADRVKQLTFTFPEEATTSSGAPFWSAPKRFPRPLQFSVDDASHLQFLLAASILRAETFGILIPDWVKSPQKLAEAVDKVIVPDFQPKKDVKIVTDEKATSMAASSIDDAAVINELVMKLET 864

HSP 2
Score: 123.25 bits (308), Expect = 1.11781e-94
Identity = 59/67 (88.06%), Postives = 62/67 (92.54%), Query Frame = 3
Query:  426 CRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
CR L G++M PIQFEKDDDTNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 865 CRQKLPSGYKMNPIQFEKDDDTNYHMDLIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 931

B9SKU8_RICCO1.46e-9477.14%
Ubiquitin-activating enzyme E1 OS=Ricinu...
HSP 1
Score: 241.891 bits (616), Expect = 1.4581e-94
Identity = 108/140 (77.14%), Postives = 128/140 (91.43%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLE 421
+C+TFQDCITWAR+KFEDYFANRVKQL +TFPEDA T+TGAPFWSAPKRFP PL+FST+DP HLHF+MA SILRAE FGIP+PDWVK+P AEAV++V++P+F+PKKD KIVTDEKATSLSTAS DD A+I+EL++KLE
Sbjct: 751 KCETFQDCITWARLKFEDYFANRVKQLIYTFPEDARTNTGAPFWSAPKRFPHPLEFSTSDPGHLHFVMAVSILRAEVFGIPVPDWVKNPKMFAEAVEKVIIPDFEPKKDAKIVTDEKATSLSTASADDGAIIHELIMKLE 890

HSP 2
Score: 129.798 bits (325), Expect = 1.4581e-94
Identity = 62/69 (89.86%), Postives = 66/69 (95.65%), Query Frame = 3
Query:  420 KQCRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
+ CR +L PG+RMKPIQFEKDDDTN+HMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 890 EHCRRHLPPGYRMKPIQFEKDDDTNFHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 958

B9GGR5_POPTR1.46e-9480.71%
Ubiquitin-activating enzyme E1 OS=Populu...
HSP 1
Score: 244.973 bits (624), Expect = 1.45868e-94
Identity = 113/140 (80.71%), Postives = 131/140 (93.57%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLE 421
+C+TFQDCITWAR++FEDYFA+RVKQL FTFPEDA+TSTGAPFWSAPKRFP PLQFSTADPSHLHF+MAASILRAETFGI +P+WVK P LAEAV++V+VPEFQP++DVKI TDEKAT++ST S+DDAAVINEL+ KLE
Sbjct: 662 KCETFQDCITWARLRFEDYFADRVKQLIFTFPEDASTSTGAPFWSAPKRFPHPLQFSTADPSHLHFVMAASILRAETFGISVPEWVKHPKTLAEAVEKVIVPEFQPREDVKIETDEKATTISTVSVDDAAVINELIRKLE 801

HSP 2
Score: 126.716 bits (317), Expect = 1.45868e-94
Identity = 61/69 (88.41%), Postives = 64/69 (92.75%), Query Frame = 3
Query:  420 KQCRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
+QCR L P +RM PIQFEKDDDTNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 801 EQCRHKLPPAYRMTPIQFEKDDDTNYHMDLIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 869

Q75VJ9_TOBAC4.22e-9482.98%
Ubiquitin-activating enzyme E1 OS=Nicoti...
HSP 1
Score: 246.899 bits (629), Expect = 4.22386e-94
Identity = 117/141 (82.98%), Postives = 131/141 (92.91%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLET 424
RCDTFQDCITWAR++FEDYFA+RVKQL FTFPE+A TS+GAPFWSAPKRFPRPLQFS D SHL FL+AASILRAETFGI IPDWVKSP LAEAVD+V+VP+FQPKKDVKIVTDEKATS++ +SIDDAAVINEL++KLET
Sbjct: 724 RCDTFQDCITWARLRFEDYFADRVKQLTFTFPEEATTSSGAPFWSAPKRFPRPLQFSVDDASHLQFLLAASILRAETFGILIPDWVKSPQNLAEAVDKVIVPDFQPKKDVKIVTDEKATSMAASSIDDAAVINELVMKLET 864

HSP 2
Score: 123.25 bits (308), Expect = 4.22386e-94
Identity = 59/67 (88.06%), Postives = 62/67 (92.54%), Query Frame = 3
Query:  426 CRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
CR L G++M PIQFEKDDDTNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 865 CRQKLPSGYKMNPIQFEKDDDTNYHMDLIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 931

B9GBE8_ORYSJ1.22e-9378.17%
Ubiquitin-activating enzyme E1 OS=Oryza ...
HSP 1
Score: 244.202 bits (622), Expect = 1.2235e-93
Identity = 111/142 (78.17%), Postives = 134/142 (94.37%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLETV 427
+C+TFQDCITWAR+KFEDYF+NRVKQL +TFPEDA TS+GAPFWSAPKRFPRPL+F T+DPS L+F++AA+ILRAETFGIPIPDWVK+P+K+AEAVD+V+VP+FQPK+ VKIVTDEKATSLS+AS+DDAAVI EL+ KLE +
Sbjct: 708 KCETFQDCITWARLKFEDYFSNRVKQLTYTFPEDAMTSSGAPFWSAPKRFPRPLEFLTSDPSQLNFILAAAILRAETFGIPIPDWVKNPAKMAEAVDKVIVPDFQPKQGVKIVTDEKATSLSSASVDDAAVIEELIAKLEAI 849

HSP 2
Score: 124.405 bits (311), Expect = 1.2235e-93
Identity = 60/63 (95.24%), Postives = 62/63 (98.41%), Query Frame = 3
Query:  438 LQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
LQPGF+MKPIQFEKDDDTNYHMD+IAG ANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 853 LQPGFQMKPIQFEKDDDTNYHMDVIAGFANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 915

B8BNT8_ORYSI1.22e-9378.17%
Ubiquitin-activating enzyme E1 OS=Oryza ...
HSP 1
Score: 244.202 bits (622), Expect = 1.22351e-93
Identity = 111/142 (78.17%), Postives = 134/142 (94.37%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLETV 427
+C+TFQDCITWAR+KFEDYF+NRVKQL +TFPEDA TS+GAPFWSAPKRFPRPL+F T+DPS L+F++AA+ILRAETFGIPIPDWVK+P+K+AEAVD+V+VP+FQPK+ VKIVTDEKATSLS+AS+DDAAVI EL+ KLE +
Sbjct: 707 KCETFQDCITWARLKFEDYFSNRVKQLTYTFPEDAMTSSGAPFWSAPKRFPRPLEFLTSDPSQLNFILAAAILRAETFGIPIPDWVKNPAKMAEAVDKVIVPDFQPKQGVKIVTDEKATSLSSASVDDAAVIEELIAKLEAI 848

HSP 2
Score: 124.405 bits (311), Expect = 1.22351e-93
Identity = 60/63 (95.24%), Postives = 62/63 (98.41%), Query Frame = 3
Query:  438 LQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
LQPGF+MKPIQFEKDDDTNYHMD+IAG ANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 852 LQPGFQMKPIQFEKDDDTNYHMDVIAGFANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 914

Q2RBM4_ORYSJ1.22e-9378.17%
Ubiquitin-activating enzyme E1 OS=Oryza ...
HSP 1
Score: 244.202 bits (622), Expect = 1.22359e-93
Identity = 111/142 (78.17%), Postives = 134/142 (94.37%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLETV 427
+C+TFQDCITWAR+KFEDYF+NRVKQL +TFPEDA TS+GAPFWSAPKRFPRPL+F T+DPS L+F++AA+ILRAETFGIPIPDWVK+P+K+AEAVD+V+VP+FQPK+ VKIVTDEKATSLS+AS+DDAAVI EL+ KLE +
Sbjct: 692 KCETFQDCITWARLKFEDYFSNRVKQLTYTFPEDAMTSSGAPFWSAPKRFPRPLEFLTSDPSQLNFILAAAILRAETFGIPIPDWVKNPAKMAEAVDKVIVPDFQPKQGVKIVTDEKATSLSSASVDDAAVIEELIAKLEAI 833

HSP 2
Score: 124.405 bits (311), Expect = 1.22359e-93
Identity = 60/63 (95.24%), Postives = 62/63 (98.41%), Query Frame = 3
Query:  438 LQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
LQPGF+MKPIQFEKDDDTNYHMD+IAG ANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 837 LQPGFQMKPIQFEKDDDTNYHMDVIAGFANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 899

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CF810751
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010246800011.04e-9885.71%GSVIVT01024680001 assembled CDS
HSP 1
Score: 253.447 bits (646), Expect = 1.04359e-98
Identity = 120/140 (85.71%), Postives = 129/140 (92.14%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLE 421
RC+TFQDCITWAR++FEDYF NRVKQL FTFPEDAATSTGAPFWSAPKRFP PLQFS AD HL+F+MAASILRAETFGIPIPDW K P KLAEAVD+V+VPEFQPK DVKIVTDEKATSLSTAS+DDAAVINELL K+E
Sbjct: 690 RCETFQDCITWARLRFEDYFVNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSAADAGHLYFVMAASILRAETFGIPIPDWAKHPKKLAEAVDKVIVPEFQPKTDVKIVTDEKATSLSTASVDDAAVINELLAKIE 829

HSP 2
Score: 124.405 bits (311), Expect = 1.04359e-98
Identity = 61/69 (88.41%), Postives = 64/69 (92.75%), Query Frame = 3
Query:  420 KQCRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
+Q +L PGFRM PIQFEKDDDTNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 829 EQSWKSLPPGFRMNPIQFEKDDDTNYHMDLIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 897

GSVIVT010303040015.14e-9885.00%GSVIVT01030304001 assembled CDS
HSP 1
Score: 252.677 bits (644), Expect = 5.1445e-98
Identity = 119/140 (85.00%), Postives = 130/140 (92.86%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLE 421
RC+TFQDCITWAR+KFEDYFANRVKQL FTFPEDAATS GAPFWSAPKRFPRPLQFS DP LHF+MAAS+LRAETFGIPIPDWVKSP K A+AV +V+VP+F PKKDVKIVTDEKATSLSTAS+DDAAVINEL++KLE
Sbjct: 662 RCETFQDCITWARLKFEDYFANRVKQLTFTFPEDAATSNGAPFWSAPKRFPRPLQFSIDDPGQLHFVMAASVLRAETFGIPIPDWVKSPMKFADAVSKVIVPDFLPKKDVKIVTDEKATSLSTASVDDAAVINELIMKLE 801

HSP 2
Score: 122.865 bits (307), Expect = 5.1445e-98
Identity = 58/69 (84.06%), Postives = 64/69 (92.75%), Query Frame = 3
Query:  420 KQCRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
++C+ L PGFRM PIQFEKDDD+NYHMD+I+ LANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 801 EKCQKKLPPGFRMNPIQFEKDDDSNYHMDLISALANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 869

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CF810751
Best 10 Hits Shown

Match Name E value Identity Description
AT2G30110.1 4.78e-9472.86%
ubiquitin-activating enzyme 1 | chr2:12...
HSP 1
Score: 231.106 bits (588), Expect = 4.77935e-94
Identity = 102/140 (72.86%), Postives = 130/140 (92.86%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKLE 421
+C+TFQDC+TWAR++FEDYF NRVKQL +TFPEDAATSTGAPFWSAPKRFPRPLQ+S++DPS L+F+ A +ILRAETFGIPIP+W K+P + AEAVDRV+VP+F+P++D KIVTDEKAT+L+TAS+DDAAVI++L+ K++
Sbjct: 724 KCETFQDCLTWARLRFEDYFVNRVKQLIYTFPEDAATSTGAPFWSAPKRFPRPLQYSSSDPSLLNFITATAILRAETFGIPIPEWTKNPKEAAEAVDRVIVPDFEPRQDAKIVTDEKATTLTTASVDDAAVIDDLIAKID 863

HSP 2
Score: 131.724 bits (330), Expect = 4.77935e-94
Identity = 64/68 (94.12%), Postives = 65/68 (95.59%), Query Frame = 3
Query:  423 QCRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
QCR NL P FRMKPIQFEKDDDTNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 864 QCRHNLSPDFRMKPIQFEKDDDTNYHMDVIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 931

AT5G06460.1 3.07e-9377.70%
ubiquitin activating enzyme 2 | chr5:19...
HSP 1
Score: 231.876 bits (590), Expect = 3.0729e-93
Identity = 108/139 (77.70%), Postives = 128/139 (92.09%), Query Frame = 2
Query:    2 RCDTFQDCITWARMKFEDYFANRVKQLAFTFPEDAATSTGAPFWSAPKRFPRPLQFSTADPSHLHFLMAASILRAETFGIPIPDWVKSPSKLAEAVDRVMVPEFQPKKDVKIVTDEKATSLSTASIDDAAVINELLVKL 418
+C++FQDCITWAR++FEDYFANRVKQL +TFPEDAATSTGAPFWSAPKRFPRPLQFS+ D SH++F+MAASILRAETFGIP P+W K+ + LAEAV+RV+VP+F+PKKD IVTDEKAT+LSTAS+DDAAVI+EL KL
Sbjct: 721 KCNSFQDCITWARLRFEDYFANRVKQLCYTFPEDAATSTGAPFWSAPKRFPRPLQFSSTDLSHINFVMAASILRAETFGIPTPEWAKTRAGLAEAVERVIVPDFEPKKDATIVTDEKATTLSTASVDDAAVIDELNAKL 859

HSP 2
Score: 128.257 bits (321), Expect = 3.0729e-93
Identity = 62/68 (91.18%), Postives = 65/68 (95.59%), Query Frame = 3
Query:  423 QCRANLQPGFRMKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAM 626
+CR +LQP FRMK IQFEKDDDTNYHMDMIAGLANMRARNYS+PEVDKLKAKFIAGRIIPAIATSTAM
Sbjct: 861 RCRMSLQPEFRMKAIQFEKDDDTNYHMDMIAGLANMRARNYSVPEVDKLKAKFIAGRIIPAIATSTAM 928

Related info for CF810751