CF810777

Information for CF810777

NameCF810777
AccessionID1723
Length608 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014530 cDNA cold acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CF810777
Sequence
GGAAAGTCGAACGCTCCCGCTTCTCAAAGCCTCTCTTCTCTCTCCATTGTTCCAGTACTA
TGCTCTCACTAACCTGCTTCCCTCTCTCTCCTCCCCCACCACTCCTCCGCCGCCGCACCA
CCACCACCACCACACCCACTCCACGCCCCTCCCGACCTCTCCGCGCCACTGCGCGAAACA
TTGCCATCGAGGAAGAAAAAGACGACGCCGTCGTTGTTAGGGGAAGAAGAGTGGGAGAAG
ATCCTCCGCTGCCGGCGGGGCTGAGGAGGGAGGCGATGCCGGGACACGTGGCGGTGATTA
TGGACGGGAACAGGAGGTGGGCCCGGATGAGGGGTTTGCCTGCTGTGTCGGGTTACGAAG
CGGGTTTAAGGGCTTTGAAGGGTATGGTGGAGATGTGTTGTAGGTGGGGGAGTTGGGGTT
CTTACTGTGTTTGCTTTCTCTTCTGATAACTGGCTTCGACCCAAGGTACAAGTAGGGTTC
TTGATGCGTTTACTTGAAGGAGGGATGAAGAATGAACTGAACAATTTCATGAAGGATAAT
ATTCGATTTTCTTGTATCGGGGATTCATCAAAGCTCCCANATCAACTAAAGGAACTGATA
ACCTATGN
Download sequence in fasta format

KEGG Analysis

Analysis Date: 01-18-2011 (KEGG analysis for Vaccinium corymbosum unigene v1)
K11778 DHDDS; cis-prenyltransferase, dehydrodolichyl diphosphate synthase [EC:2.5.1.-]

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CF810777_1_ORF2 CRC64: 3C7AFF7D941DA8D0 LENGTH: 63 aa
noIPR
unintegrated
unintegrated
seg [1-33]? NA seg seg seg
SEQUENCE: CF810777_1_ORF3 CRC64: 094A11ADB1B06A27 LENGTH: 76 aa
InterPro
IPR001441
Family
Di-trans-poly-cis-decaprenylcistransferase-like
G3DSA:3.40.1180.10 [10-74]T 2.2e-13 G3DSA:3.40.1180.10 no description no description
PTHR10291 [11-74]T 2.6e-12 PTHR10291 DEHYDRODOLICHYL DIPHOSPHATE SYNTHASE DEHYDRODOLICHYL DIPHOSPHATE SYNTHASE
PF01255 [10-75]T 1.5e-14 PF01255 Prenyltransf Prenyltransf
SSF64005 [11-76]T 2e-10 SSF64005 Undecaprenyl diphosphate synthase Undecaprenyl diphosphate synthase
noIPR
unintegrated
unintegrated
seg [7-14]? NA seg seg seg
SEQUENCE: CF810777_2_ORF1 CRC64: 3D5AEC253D6AB975 LENGTH: 72 aa
noIPR
unintegrated
unintegrated
seg [5-16]? NA seg seg[25-54]? NA seg seg[55-72]? NA seg seg seg
SEQUENCE: CF810777_2_ORF2 CRC64: B7FB74E806F62FE0 LENGTH: 60 aa
noIPR
unintegrated
unintegrated
seg [1-29]? NA seg seg seg
SEQUENCE: CF810777_3_ORF1 CRC64: 896E9BADCF0702B2 LENGTH: 147 aa
InterPro
IPR001441
Family
Di-trans-poly-cis-decaprenylcistransferase-like
G3DSA:3.40.1180.10 [87-136]T 8.4e-15 G3DSA:3.40.1180.10 no description no description
PTHR10291 [74-136]T 8.7e-16 PTHR10291 DEHYDRODOLICHYL DIPHOSPHATE SYNTHASE DEHYDRODOLICHYL DIPHOSPHATE SYNTHASE
PF01255 [99-136]T 6.9e-10 PF01255 Prenyltransf Prenyltransf
SSF64005 [88-136]T 3.7e-14 SSF64005 Undecaprenyl diphosphate synthase Undecaprenyl diphosphate synthase
noIPR
unintegrated
unintegrated
seg [27-58]? NA seg seg[70-78]? NA seg seg seg
SEQUENCE: CF810777_4_ORF2 CRC64: 87DD5D2088CF6C89 LENGTH: 63 aa
noIPR
unintegrated
unintegrated
seg [22-40]? NA seg seg seg
SEQUENCE: CF810777_4_ORF3 CRC64: 30E90A8CE0BAB92F LENGTH: 52 aa
noIPR
unintegrated
unintegrated
seg [17-46]? NA seg seg seg
SEQUENCE: CF810777_5_ORF2 CRC64: 579DB6B381BCE248 LENGTH: 117 aa
noIPR
unintegrated
unintegrated
seg [27-55]? NA seg seg[60-91]? NA seg seg seg
SEQUENCE: CF810777_6_ORF2 CRC64: 0BE2E7DF0CA22363 LENGTH: 70 aa
noIPR
unintegrated
unintegrated
seg [54-67]? NA seg seg seg
SEQUENCE: CF810777_6_ORF3 CRC64: 7F04DFAADD3F0DA0 LENGTH: 98 aa
noIPR
unintegrated
unintegrated
seg [12-41]? NA seg seg[69-98]? NA seg seg seg

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CF810777
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0009s050101.30e-3269.64%POPTR_0009s05010.1
HSP 1
Score: 82.8037 bits (203), Expect = 1.30032e-32
Identity = 39/56 (69.64%), Postives = 45/56 (80.36%), Query Frame = 3
Query:  246 PLPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVS-GYEAGLRALKGMVEMCCRWG 410
PLP GL REAMP HVAVIMDGN RWAR RG A+S G+EAG R+L+ +VE+CC WG
Sbjct: 61 PLPEGLLREAMPRHVAVIMDGNARWARQRGFIALSAGHEAGARSLRELVELCCDWG 116

HSP 2
Score: 74.7146 bits (182), Expect = 1.30032e-32
Identity = 36/60 (60.00%), Postives = 46/60 (76.67%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELIT 603
TVFAFS DNW+RPKV+V FLM L E +K+EL+NF++ R S IGDSS+L LK+LI+
Sbjct: 121 TVFAFSYDNWIRPKVEVDFLMSLFERMLKSELDNFVRQGARVSTIGDSSRLSESLKKLIS 180

POPTR_0001s258006.34e-3266.07%POPTR_0001s25800.1
HSP 1
Score: 80.1073 bits (196), Expect = 6.33905e-32
Identity = 37/56 (66.07%), Postives = 43/56 (76.79%), Query Frame = 3
Query:  246 PLPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVS-GYEAGLRALKGMVEMCCRWG 410
PLP GLRRE MP HVAVIMDGN +WAR RG A S G+EAG R+L+ +V+ CC WG
Sbjct: 61 PLPEGLRREVMPRHVAVIMDGNAKWARQRGFSAASAGHEAGGRSLRELVKSCCEWG 116

HSP 2
Score: 75.0998 bits (183), Expect = 6.33905e-32
Identity = 36/60 (60.00%), Postives = 47/60 (78.33%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELIT 603
TVFAFS DNW RPK++V FL+ L E +++EL+NFM+ IR S IGDSS+LP LK+LI+
Sbjct: 121 TVFAFSYDNWTRPKMEVVFLLSLFERMLQSELDNFMRKGIRVSTIGDSSRLPESLKKLIS 180

POPTR_0001s319708.45e-2864.81%POPTR_0001s31970.1
HSP 1
Score: 80.4925 bits (197), Expect = 8.45061e-28
Identity = 35/54 (64.81%), Postives = 43/54 (79.63%), Query Frame = 3
Query:  249 LPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
LP GLRRE+MP HVAVIMDGN RWAR RG+ SG+EAG+R+LK + +C +WG
Sbjct: 62 LPEGLRRESMPRHVAVIMDGNSRWARQRGMLTPSGHEAGVRSLKEFIRLCLQWG 115

HSP 2
Score: 60.8474 bits (146), Expect = 8.45061e-28
Identity = 27/59 (45.76%), Postives = 42/59 (71.19%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
TVFAFS DNW RPK +V +M ++E +K+ L++F+++ R S IGD+S++P L+ I
Sbjct: 120 TVFAFSIDNWTRPKEEVDIVMTMIENLLKSGLDDFIREGTRVSIIGDTSRVPKSLQRTI 178

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CF810777
Best 10 Hits Shown

Match Name E value Identity Description
ppa016682m 5.42e-3370.91%ppa016682m
HSP 1
Score: 86.6557 bits (213), Expect = 5.42395e-33
Identity = 39/55 (70.91%), Postives = 46/55 (83.64%), Query Frame = 3
Query:  246 PLPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
PLPAGL+RE MP HVAVIMDGN RW R RGLPA SG+EAG R+L+ +VE+C +WG
Sbjct: 76 PLPAGLQRELMPRHVAVIMDGNVRWERRRGLPAGSGHEAGARSLRELVELCWKWG 130

HSP 2
Score: 71.633 bits (174), Expect = 5.42395e-33
Identity = 34/60 (56.67%), Postives = 45/60 (75.00%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELIT 603
TVFAFS DNW+RP+V+V FLM L E +E+++F +D IR S IGD SKLP L++LI+
Sbjct: 135 TVFAFSYDNWVRPQVEVDFLMNLFEKMTSSEIDSFARDGIRISVIGDLSKLPNSLQKLIS 194

ppa007586m 3.70e-0846.67%ppa007586m
HSP 1
Score: 48.9062 bits (115), Expect = 3.69964e-08
Identity = 21/45 (46.67%), Postives = 29/45 (64.44%), Query Frame = 3
Query:  276 MPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
+P H+A IMDGNRR+A+ R LP G++AG AL ++ C G
Sbjct: 32 IPEHIAFIMDGNRRYAKRRNLPVAEGHKAGYLALMSILRYCYELG 76

HSP 2
Score: 25.409 bits (54), Expect = 3.69964e-08
Identity = 13/25 (52.00%), Postives = 17/25 (68.00%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLE 498
TV+AFS DN+ R +V LM LL+
Sbjct: 81 TVYAFSIDNFKRRPEEVQTLMDLLQ 105

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CF810777
Best 10 Hits Shown

Match Name E value Identity Description
DDPS2_ARATH1.47e-2754.24%
Dehydrodolichyl diphosphate synthase 2 O...
HSP 1
Score: 73.1738 bits (178), Expect = 1.47348e-27
Identity = 32/59 (54.24%), Postives = 42/59 (71.19%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
TVFAFS+DNW+RP++++ FL L E +K E N K+N+R S IGDSSKLP L +I
Sbjct: 126 TVFAFSTDNWIRPRIEIDFLFSLFERSLKTEFQNLAKNNVRISIIGDSSKLPKSLLRVI 184

HSP 2
Score: 70.4774 bits (171), Expect = 1.47348e-27
Identity = 32/58 (55.17%), Postives = 40/58 (68.97%), Query Frame = 3
Query:  237 EDPPLPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
E+ LP L E MP HVA+IMDGN RWA+ RGL G+ AG+ ALK +VE+C +WG
Sbjct: 64 EEETLPEELHAELMPKHVAIIMDGNGRWAKNRGLQPWDGHRAGVEALKEIVELCGKWG 121

UPPS_PROMM1.08e-2054.72%
Undecaprenyl pyrophosphate synthase OS=P...
HSP 1
Score: 66.6254 bits (161), Expect = 1.07664e-20
Identity = 29/53 (54.72%), Postives = 37/53 (69.81%), Query Frame = 3
Query:  252 PAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
P+GL +P HVAVIMDGN RWA+ RGLP + G+ AG+ ALK + +C WG
Sbjct: 18 PSGLDPYRLPNHVAVIMDGNGRWAKARGLPRMVGHRAGVEALKRTLRLCSDWG 70

HSP 2
Score: 53.9138 bits (128), Expect = 1.07664e-20
Identity = 25/60 (41.67%), Postives = 38/60 (63.33%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELIT 603
T +AFS++NW RP +V FLM L E ++ EL + ++ +R +GD LP L+ELI+
Sbjct: 75 TAYAFSTENWSRPGDEVNFLMTLFERVLQRELESLEREKVRIRFLGDLEGLPSGLQELIS 134

UPPS_PROMA3.08e-2047.27%
Undecaprenyl pyrophosphate synthase OS=P...
HSP 1
Score: 60.4622 bits (145), Expect = 3.08114e-20
Identity = 26/55 (47.27%), Postives = 35/55 (63.64%), Query Frame = 3
Query:  246 PLPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
PLPA + +P H+A+IMDGN RWA + LP G+ AG+ ALK + +C WG
Sbjct: 17 PLPASIDPLRLPEHIAIIMDGNGRWANAKKLPRAMGHSAGVDALKQTLRLCNDWG 71

HSP 2
Score: 58.5362 bits (140), Expect = 3.08114e-20
Identity = 27/59 (45.76%), Postives = 40/59 (67.80%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
TV+AFS++NW RPK +V FLM L E +K EL + ++ S +GD +LP +L++LI
Sbjct: 76 TVYAFSTENWSRPKEEVNFLMTLFERVLKKELEALNLEEVQISFLGDLDQLPTRLQDLI 134

UPPS_ANAVT5.22e-2053.70%
Undecaprenyl pyrophosphate synthase OS=A...
HSP 1
Score: 67.781 bits (164), Expect = 5.22154e-20
Identity = 29/54 (53.70%), Postives = 39/54 (72.22%), Query Frame = 3
Query:  249 LPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
LP L+RE +P HVAVIMDGN RWA+ +GLP + G++ G+ ALK ++ C WG
Sbjct: 11 LPLDLKRELLPKHVAVIMDGNGRWAKRQGLPRIMGHKRGVDALKDLLRCCRDWG 64

HSP 2
Score: 50.447 bits (119), Expect = 5.22154e-20
Identity = 21/60 (35.00%), Postives = 39/60 (65.00%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELIT 603
T +AFS++NW RP+ +V FLM L + ++ EL +++N++ +G+ + LP L+ I+
Sbjct: 69 TAYAFSTENWKRPQEEVEFLMTLFQRVLRQELREMVEENVQIQFVGNLAALPRSLQAEIS 128

UPPS1_ANASP5.22e-2053.70%
Undecaprenyl pyrophosphate synthase 1 OS...
HSP 1
Score: 67.781 bits (164), Expect = 5.22154e-20
Identity = 29/54 (53.70%), Postives = 39/54 (72.22%), Query Frame = 3
Query:  249 LPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
LP L+RE +P HVAVIMDGN RWA+ +GLP + G++ G+ ALK ++ C WG
Sbjct: 11 LPLDLKRELLPKHVAVIMDGNGRWAKRQGLPRIMGHKRGVDALKDLLRCCRDWG 64

HSP 2
Score: 50.447 bits (119), Expect = 5.22154e-20
Identity = 21/60 (35.00%), Postives = 39/60 (65.00%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELIT 603
T +AFS++NW RP+ +V FLM L + ++ EL +++N++ +G+ + LP L+ I+
Sbjct: 69 TAYAFSTENWKRPQEEVEFLMTLFQRVLRQELREMVEENVQIQFVGNLTALPRSLQAEIS 128

UPPS_SYNPX6.78e-2052.83%
Undecaprenyl pyrophosphate synthase OS=S...
HSP 1
Score: 63.5438 bits (153), Expect = 6.78292e-20
Identity = 28/53 (52.83%), Postives = 35/53 (66.04%), Query Frame = 3
Query:  252 PAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
P L + +P HVAVIMDGN RWA RGLP + G+ AG+ ALK + +C WG
Sbjct: 18 PPELDGDRLPVHVAVIMDGNGRWAEARGLPRMMGHRAGVEALKSTLRLCSDWG 70

HSP 2
Score: 54.299 bits (129), Expect = 6.78292e-20
Identity = 25/59 (42.37%), Postives = 37/59 (62.71%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
T +AFS++NW RP +V FLM L E ++ EL ++ +R +GD LP +L+ELI
Sbjct: 75 TAYAFSTENWSRPGDEVNFLMTLFERVLQKELRTLEEEQVRIRFLGDLDALPLKLQELI 133

UPPS_SYNY31.15e-1948.15%
Undecaprenyl pyrophosphate synthase OS=S...
HSP 1
Score: 64.3142 bits (155), Expect = 1.14868e-19
Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 3
Query:  249 LPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
LP L ++ +P HVAVIMDGN RWA+ RG+P + G++ G+ +LK ++ C WG
Sbjct: 11 LPPDLDQQRLPQHVAVIMDGNGRWAKQRGMPRIMGHQRGVDSLKNLLRCCDDWG 64

HSP 2
Score: 52.7582 bits (125), Expect = 1.14868e-19
Identity = 24/59 (40.68%), Postives = 37/59 (62.71%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
T +AFS++NW RP +V FLM L E ++ EL M +N+R +G+ + LP L++ I
Sbjct: 69 TAYAFSTENWGRPLEEVEFLMTLFERVLRRELKEMMAENVRIRFVGNLTSLPRSLQDEI 127

UPPS2_ANASP2.06e-1849.06%
Undecaprenyl pyrophosphate synthase 2 OS...
HSP 1
Score: 60.8474 bits (146), Expect = 2.06346e-18
Identity = 26/53 (49.06%), Postives = 34/53 (64.15%), Query Frame = 3
Query:  252 PAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
P L + +P H+AVIMDGN RWA RGLP ++G+ G R LK ++ C WG
Sbjct: 15 PPDLDPQKIPQHIAVIMDGNGRWATSRGLPRIAGHRQGARTLKELLRCCKDWG 67

HSP 2
Score: 51.9878 bits (123), Expect = 2.06346e-18
Identity = 24/56 (42.86%), Postives = 36/56 (64.29%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLK 591
T +AFS++NW RP +V FLM L E ++ EL+ ++ +R S IGD + LP L+
Sbjct: 72 TAYAFSTENWQRPIEEVDFLMLLFERLLRRELSQMHREGVRISFIGDLTALPKSLQ 127

UPPS_THEEB2.69e-1851.85%
Undecaprenyl pyrophosphate synthase OS=T...
HSP 1
Score: 65.4698 bits (158), Expect = 2.6852e-18
Identity = 28/54 (51.85%), Postives = 37/54 (68.52%), Query Frame = 3
Query:  249 LPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
LPA L R+ +P HVAVIMDGN RWA+ R LP + G++ G+ LK ++ C WG
Sbjct: 13 LPADLDRDRLPRHVAVIMDGNGRWAKQRNLPRIMGHQRGVDTLKDLLRCCKDWG 66

HSP 2
Score: 46.9802 bits (110), Expect = 2.6852e-18
Identity = 21/56 (37.50%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLK 591
T +AFS++NW RP +V FLM L E ++ EL + + ++ +GD + LP L+
Sbjct: 71 TAYAFSTENWGRPLPEVEFLMTLFEQVLRRELGEMVAEGVQIHFVGDLTCLPKSLQ 126

UPPS_GLOVI2.69e-1851.85%
Undecaprenyl pyrophosphate synthase OS=G...
HSP 1
Score: 61.6178 bits (148), Expect = 2.68584e-18
Identity = 28/54 (51.85%), Postives = 35/54 (64.81%), Query Frame = 3
Query:  249 LPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
LP+ L +P HVA IMDGN RWA R LP V G++AG+ ALK ++ C WG
Sbjct: 11 LPSDLDPNRLPRHVAAIMDGNGRWASKRNLPRVMGHQAGVSALKELLRCCKDWG 64

HSP 2
Score: 50.8322 bits (120), Expect = 2.68584e-18
Identity = 23/59 (38.98%), Postives = 37/59 (62.71%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
TV+AFS++NW RP+ +V FLM L E + +EL+ + + +R +G + LP L+ I
Sbjct: 69 TVYAFSTENWKRPQYEVEFLMALFEKVLNHELSEMVDEGVRIRFVGALAHLPGALQSAI 127

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CF810777
Best 10 Hits Shown

Match Name E value Identity Description
A5BX88_VITVI4.77e-2967.92%
Putative uncharacterized protein OS=Viti...
HSP 1
Score: 84.3445 bits (207), Expect = 4.7673e-29
Identity = 36/53 (67.92%), Postives = 45/53 (84.91%), Query Frame = 3
Query:  252 PAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
P GLRRE MP HVAVIMDGN RWA+ RGLPA SG++AG+R+L+ +V +CC+WG
Sbjct: 77 PDGLRRELMPEHVAVIMDGNVRWAQKRGLPAASGHQAGVRSLRELVGLCCKWG 129

HSP 2
Score: 68.1662 bits (165), Expect = 4.7673e-29
Identity = 35/59 (59.32%), Postives = 44/59 (74.58%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
+VFAFS DNW R + +VGFLM L+E +K EL NF ++ IR S IGD SKLP QL++LI
Sbjct: 134 SVFAFSYDNWSRSEGEVGFLMSLIERVVKAELPNFGREGIRVSVIGDLSKLPEQLQKLI 192

B9GII5_POPTR4.85e-2965.45%
Predicted protein (Fragment) OS=Populus ...
HSP 1
Score: 77.411 bits (189), Expect = 4.84515e-29
Identity = 36/55 (65.45%), Postives = 42/55 (76.36%), Query Frame = 3
Query:  249 LPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVS-GYEAGLRALKGMVEMCCRWG 410
LP GLRRE MP HVAVIMDGN +WAR RG A S G+EAG R+L+ +V+ CC WG
Sbjct: 1 LPEGLRREVMPRHVAVIMDGNAKWARQRGFSAASAGHEAGGRSLRELVKSCCEWG 55

HSP 2
Score: 75.0998 bits (183), Expect = 4.84515e-29
Identity = 36/60 (60.00%), Postives = 47/60 (78.33%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELIT 603
TVFAFS DNW RPK++V FL+ L E +++EL+NFM+ IR S IGDSS+LP LK+LI+
Sbjct: 60 TVFAFSYDNWTRPKMEVVFLLSLFERMLQSELDNFMRKGIRVSTIGDSSRLPESLKKLIS 119

B5X0P4_ARATH2.08e-2654.24%
At5g58770 OS=Arabidopsis thaliana PE=2 S...
HSP 1
Score: 73.1738 bits (178), Expect = 2.08185e-26
Identity = 32/59 (54.24%), Postives = 42/59 (71.19%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
TVFAFS+DNW+RP++++ FL L E +K E N K+N+R S IGDSSKLP L +I
Sbjct: 126 TVFAFSTDNWIRPRIEIDFLFSLFERSLKTEFQNLAKNNVRISIIGDSSKLPKSLLRVI 184

HSP 2
Score: 70.4774 bits (171), Expect = 2.08185e-26
Identity = 32/58 (55.17%), Postives = 40/58 (68.97%), Query Frame = 3
Query:  237 EDPPLPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
E+ LP L E MP HVA+IMDGN RWA+ RGL G+ AG+ ALK +VE+C +WG
Sbjct: 64 EEETLPEELHAELMPKHVAIIMDGNGRWAKNRGLQPWDGHRAGVEALKEIVELCGKWG 121

A9RXS2_PHYPA2.09e-2653.33%
Predicted protein (Fragment) OS=Physcomi...
HSP 1
Score: 75.485 bits (184), Expect = 2.09284e-26
Identity = 32/60 (53.33%), Postives = 47/60 (78.33%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELIT 603
TVFAFS++NWLRPK++V FLM L E +KNEL++ K+N+R C+GD + LP L++++T
Sbjct: 63 TVFAFSTENWLRPKMEVDFLMMLFENVLKNELSSLAKENVRVHCMGDLTLLPVTLRDMVT 122

HSP 2
Score: 68.1662 bits (165), Expect = 2.09284e-26
Identity = 31/58 (53.45%), Postives = 39/58 (67.24%), Query Frame = 3
Query:  237 EDPPLPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
E P L L MP HVA+IMDGN RWA RG+PA G+EAG+R+LK +V++ WG
Sbjct: 1 ESPQLAEELDASVMPKHVAIIMDGNSRWAERRGMPASMGHEAGVRSLKEVVKLAHTWG 58

B9SI16_RICCO2.71e-2657.63%
Undecaprenyl pyrophosphate synthetase, p...
HSP 1
Score: 72.0182 bits (175), Expect = 2.71008e-26
Identity = 34/59 (57.63%), Postives = 43/59 (72.88%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
TVFAFS +NW RPKV++ FLM L E +K+EL N +++ IR S IGD SKLP L+ LI
Sbjct: 127 TVFAFSCENWTRPKVEIDFLMSLFERVLKSELENLLREGIRVSIIGDVSKLPESLQRLI 185

HSP 2
Score: 71.2478 bits (173), Expect = 2.71008e-26
Identity = 33/59 (55.93%), Postives = 42/59 (71.19%), Query Frame = 3
Query:  237 EDP-PLPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
+DP PLP GL E MP HVAVIMDGN RWA+ +G P G+EAG+R+L ++ +C WG
Sbjct: 64 DDPEPLPDGLLLELMPRHVAVIMDGNGRWAKQQGWPPSKGHEAGVRSLMEIMNLCGHWG 122

A9T0L2_PHYPA3.54e-2656.90%
Predicted protein OS=Physcomitrella pate...
HSP 1
Score: 71.633 bits (174), Expect = 3.54338e-26
Identity = 33/58 (56.90%), Postives = 41/58 (70.69%), Query Frame = 3
Query:  237 EDPPLPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
E P LP L A+P HVA+IMDGN RWA RGLPA G+EAG+R+LK +V++ WG
Sbjct: 10 EVPELPEELNPSALPKHVAIIMDGNSRWAERRGLPASMGHEAGVRSLKEVVKLAHTWG 67

HSP 2
Score: 71.2478 bits (173), Expect = 3.54338e-26
Identity = 31/60 (51.67%), Postives = 43/60 (71.67%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELIT 603
TVFAFS++NWLRPK +V FLM L E +KNEL+ K+N+R C+GD LP L+ +++
Sbjct: 72 TVFAFSTENWLRPKTEVDFLMLLFENVLKNELSILAKENVRVHCMGDLRSLPESLRNMVS 131

B9HP45_POPTR4.62e-2660.00%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 74.7146 bits (182), Expect = 4.62352e-26
Identity = 36/60 (60.00%), Postives = 46/60 (76.67%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELIT 603
TVFAFS DNW+RPKV+V FLM L E +K+EL+NF++ R S IGDSS+L LK+LI+
Sbjct: 51 TVFAFSYDNWIRPKVEVDFLMSLFERMLKSELDNFVRQGARVSTIGDSSRLSESLKKLIS 110

HSP 2
Score: 67.781 bits (164), Expect = 4.62352e-26
Identity = 31/46 (67.39%), Postives = 37/46 (80.43%), Query Frame = 3
Query:  276 MPGHVAVIMDGNRRWARMRGLPAVS-GYEAGLRALKGMVEMCCRWG 410
MP HVAVIMDGN RWAR RG A+S G+EAG R+L+ +VE+CC WG
Sbjct: 1 MPRHVAVIMDGNARWARQRGFIALSAGHEAGARSLRELVELCCDWG 46

B9GGB3_POPTR1.02e-2564.81%
Predicted protein (Fragment) OS=Populus ...
HSP 1
Score: 80.4925 bits (197), Expect = 1.01904e-25
Identity = 35/54 (64.81%), Postives = 43/54 (79.63%), Query Frame = 3
Query:  249 LPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
LP GLRRE+MP HVAVIMDGN RWAR RG+ SG+EAG+R+LK + +C +WG
Sbjct: 1 LPEGLRRESMPRHVAVIMDGNSRWARQRGMLTPSGHEAGVRSLKEFIRLCLQWG 54

HSP 2
Score: 60.8474 bits (146), Expect = 1.01904e-25
Identity = 27/59 (45.76%), Postives = 42/59 (71.19%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
TVFAFS DNW RPK +V +M ++E +K+ L++F+++ R S IGD+S++P L+ I
Sbjct: 59 TVFAFSIDNWTRPKEEVDIVMTMIENLLKSGLDDFIREGTRVSIIGDTSRVPKSLQRTI 117

D7SJY4_VITVI1.02e-2566.67%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 73.1738 bits (178), Expect = 1.01999e-25
Identity = 30/45 (66.67%), Postives = 39/45 (86.67%), Query Frame = 3
Query:  276 MPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
MP HVAVIMDGN RWA+ RGLPA SG++AG+R+L+ +V +CC+WG
Sbjct: 1 MPEHVAVIMDGNVRWAQKRGLPAASGHQAGVRSLRELVGLCCKWG 45

HSP 2
Score: 68.1662 bits (165), Expect = 1.01999e-25
Identity = 35/59 (59.32%), Postives = 44/59 (74.58%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
+VFAFS DNW R + +VGFLM L+E +K EL NF ++ IR S IGD SKLP QL++LI
Sbjct: 50 SVFAFSYDNWSRSEGEVGFLMSLIERVVKAELPNFGREGIRVSVIGDLSKLPEQLQKLI 108

D7MQH3_ARALY1.32e-2552.54%
Putative uncharacterized protein OS=Arab...
HSP 1
Score: 72.0182 bits (175), Expect = 1.3185e-25
Identity = 31/59 (52.54%), Postives = 43/59 (72.88%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
TVFAFS+DNW+RP++++ FL L E +K+E N ++N+R S IGDSSKLP L +I
Sbjct: 126 TVFAFSTDNWIRPRIEIDFLFSLFERSLKSEFQNLAENNVRISIIGDSSKLPKSLLRVI 184

HSP 2
Score: 68.9366 bits (167), Expect = 1.3185e-25
Identity = 31/58 (53.45%), Postives = 41/58 (70.69%), Query Frame = 3
Query:  237 EDPPLPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
E+ LP L+ E MP HVA+IMDGN RWA+ RGL G+ AG+ ALK +V++C +WG
Sbjct: 64 EEETLPEELQPELMPKHVAIIMDGNGRWAKNRGLQPWDGHRAGVEALKEIVKLCGKWG 121

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CF810777
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010247460015.14e-2866.67%GSVIVT01024746001 assembled CDS
HSP 1
Score: 73.1738 bits (178), Expect = 5.14402e-28
Identity = 30/45 (66.67%), Postives = 39/45 (86.67%), Query Frame = 3
Query:  276 MPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
MP HVAVIMDGN RWA+ RGLPA SG++AG+R+L+ +V +CC+WG
Sbjct: 1 MPEHVAVIMDGNVRWAQKRGLPAASGHQAGVRSLRELVGLCCKWG 45

HSP 2
Score: 68.1662 bits (165), Expect = 5.14402e-28
Identity = 35/59 (59.32%), Postives = 44/59 (74.58%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
+VFAFS DNW R + +VGFLM L+E +K EL NF ++ IR S IGD SKLP QL++LI
Sbjct: 50 SVFAFSYDNWSRSEGEVGFLMSLIERVVKAELPNFGREGIRVSVIGDLSKLPEQLQKLI 108

GSVIVT010056180019.28e-0746.67%GSVIVT01005618001 assembled CDS
HSP 1
Score: 46.9802 bits (110), Expect = 9.28339e-07
Identity = 21/45 (46.67%), Postives = 30/45 (66.67%), Query Frame = 3
Query:  276 MPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
+P H+A IMDGNRR+A+ L +GY+AG AL M++ C + G
Sbjct: 28 IPNHIAFIMDGNRRYAKKWKLEEGAGYKAGFLALLSMIKYCYKLG 72

HSP 2
Score: 22.3274 bits (46), Expect = 9.28339e-07
Identity = 9/23 (39.13%), Postives = 16/23 (69.57%), Query Frame = 1
Query:  427 VFAFSSDNWLRPKVQVGFLMRLL 495
++AFS DN+ R +V ++M L+
Sbjct: 78 IYAFSIDNFRRRPQEVQYVMDLM 100

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CF810777
Best 10 Hits Shown

Match Name E value Identity Description
AT5G58770.1 1.53e-2854.24%
Undecaprenyl pyrophosphate synthetase f...
HSP 1
Score: 73.1738 bits (178), Expect = 1.52925e-28
Identity = 32/59 (54.24%), Postives = 42/59 (71.19%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
TVFAFS+DNW+RP++++ FL L E +K E N K+N+R S IGDSSKLP L +I
Sbjct: 126 TVFAFSTDNWIRPRIEIDFLFSLFERSLKTEFQNLAKNNVRISIIGDSSKLPKSLLRVI 184

HSP 2
Score: 70.4774 bits (171), Expect = 1.52925e-28
Identity = 32/58 (55.17%), Postives = 40/58 (68.97%), Query Frame = 3
Query:  237 EDPPLPAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
E+ LP L E MP HVA+IMDGN RWA+ RGL G+ AG+ ALK +VE+C +WG
Sbjct: 64 EEETLPEELHAELMPKHVAIIMDGNGRWAKNRGLQPWDGHRAGVEALKEIVELCGKWG 121

AT5G58780.1 1.09e-1756.00%
Undecaprenyl pyrophosphate synthetase f...
HSP 1
Score: 58.9214 bits (141), Expect = 1.0903e-17
Identity = 28/50 (56.00%), Postives = 34/50 (68.00%), Query Frame = 3
Query:  261 LRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
L+RE MP HVAVIMDGNRRWA+ GL G+EAG + L E+C + G
Sbjct: 65 LQRELMPRHVAVIMDGNRRWAKRAGLLTSQGHEAGAKRLIEFSELCFKLG 114

HSP 2
Score: 48.1358 bits (113), Expect = 1.0903e-17
Identity = 21/55 (38.18%), Postives = 37/55 (67.27%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQL 588
+ FAFS++NW R K++V LM L++ +K+++ F ++ R S IG+ +K+P L
Sbjct: 119 SAFAFSTENWGRHKIEVKCLMSLIQHYLKSKIQYFQREETRVSVIGNLTKIPESL 173

AT2G23410.1 3.29e-1652.94%
cis-prenyltransferase | chr2:9966247-99...
HSP 1
Score: 59.6918 bits (143), Expect = 3.28843e-16
Identity = 27/51 (52.94%), Postives = 34/51 (66.67%), Query Frame = 3
Query:  258 GLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
GL+RE MP HVA I+DGNRRWA+ GL G+EAG + L + E+C G
Sbjct: 64 GLQRELMPRHVAFILDGNRRWAKRAGLTTSQGHEAGAKRLIDIAELCFELG 114

HSP 2
Score: 42.3578 bits (98), Expect = 3.28843e-16
Identity = 20/56 (35.71%), Postives = 35/56 (62.50%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEG-GMKNELNNFMKDNIRFSCIGDSSKLPXQL 588
+ FAFS++NW R K+++ LM L++ K+ + F + +R S IG+ +K+P L
Sbjct: 119 SAFAFSTENWGRDKIEIDNLMSLIQHYRNKSNIKFFHRSEVRVSVIGNKTKIPESL 174

AT5G58784.1 3.29e-1653.06%
Undecaprenyl pyrophosphate synthetase f...
HSP 1
Score: 53.9138 bits (128), Expect = 3.28873e-16
Identity = 26/49 (53.06%), Postives = 30/49 (61.22%), Query Frame = 3
Query:  267 REAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWGS 413
R MP HVAVI+DGNRRWA RGL G+EAG R L + C G+
Sbjct: 67 RNIMPKHVAVILDGNRRWAEKRGLGTSEGHEAGARRLMENAKDCFAMGT 115

HSP 2
Score: 48.1358 bits (113), Expect = 3.28873e-16
Identity = 24/59 (40.68%), Postives = 37/59 (62.71%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQLKELI 600
++FAFS++NW RP+ +V LM L E + +++ D I+ S IG+ +KLP L LI
Sbjct: 119 SLFAFSTENWERPEDEVKCLMALFEKYLASDMPYLRSDKIKISVIGNRTKLPESLLGLI 177

AT2G23400.1 5.58e-1648.00%
Undecaprenyl pyrophosphate synthetase f...
HSP 1
Score: 55.0694 bits (131), Expect = 5.58138e-16
Identity = 24/50 (48.00%), Postives = 33/50 (66.00%), Query Frame = 3
Query:  261 LRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
L+RE MP HV+ I+DGNRRWA+ GL G+EAG + + + E+C G
Sbjct: 31 LQRELMPRHVSFILDGNRRWAKRDGLTTAQGHEAGTKRIIEIAEVCFELG 80

HSP 2
Score: 46.2098 bits (108), Expect = 5.58138e-16
Identity = 21/55 (38.18%), Postives = 33/55 (60.00%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNNFMKDNIRFSCIGDSSKLPXQL 588
+ FAFS++NW R K +V LM L +K+ + F + +R S IG+ +K+P L
Sbjct: 85 SAFAFSTENWGRDKFEVKCLMSLFNHYLKSNIQYFQRKEVRVSVIGNKTKIPESL 139

AT5G58782.1 9.83e-1141.98%
Undecaprenyl pyrophosphate synthetase f...
HSP 1
Score: 63.5438 bits (153), Expect = 9.83359e-11
Identity = 34/81 (41.98%), Postives = 44/81 (54.32%), Query Frame = 3
Query:  252 PAGLRREAMPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG------------SWGSY-----CVCFLF 443
P L+RE MP HVAVIMDGNRRWA+ GL GYEAG + L ++C + G +WG + C+ +LF
Sbjct: 49 PKELQRELMPRHVAVIMDGNRRWAKQTGLLTSQGYEAGAKRLLEFADLCFKLGINTVSAFAFSTENWGRHKIEVKCLMYLF 129

AT2G17570.1 6.16e-0748.89%
Undecaprenyl pyrophosphate synthetase f...
HSP 1
Score: 46.595 bits (109), Expect = 6.16451e-07
Identity = 22/45 (48.89%), Postives = 30/45 (66.67%), Query Frame = 3
Query:  276 MPGHVAVIMDGNRRWARMRGLPAVSGYEAGLRALKGMVEMCCRWG 410
+P H+A IMDGNRR+A+ GL SG++AG AL M++ C G
Sbjct: 39 IPCHIAFIMDGNRRYAKKCGLLDGSGHKAGFSALMSMLQYCYELG 83

HSP 2
Score: 23.8682 bits (50), Expect = 6.16451e-07
Identity = 18/59 (30.51%), Postives = 31/59 (52.54%), Query Frame = 1
Query:  424 TVFAFSSDNWLRPKVQVGFLMRLLEGGMKNELNN---FMKDNIRFSCIGDSSKLPXQLK 591
T++AFS DN+ R +V +M L+ +K+ L + IR IG+ + L Q++
Sbjct: 88 TIYAFSIDNFRRKPEEVESVMDLMLEKIKSLLEKESIVHQYGIRVYFIGNLALLNDQVR 146

Related info for CF810777