CF810648

Information for CF810648

NameCF810648
AccessionID1854
Length360 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014530 cDNA cold acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CF810648
Sequence
ATTATCGTTTGCATATGGCGATAGCGGATAAATGGATAGAGCTTCTCAAGAAAAGGGATG
AGGATTGGAGAGTGGGTGATATTGTTTACACACTCACCAACAGAAGGTGGTTGGAAAAGT
GTGTTTCTTATGCAGAAAGTCATGATCAAGCTCTAGTTGGTGACAAGACAATTGCTTTTT
GGTTGATGGACAAGGATATGTATGACTTCATGGCTTTGGATAGACCATCAACTCCACTGG
TAGATCGTGGAATAGCATTGCACAAAATGATTANACTTATTACCATGGGGTTAGGTGGAG
AAGGTTACCTAAATTTCATGGGAAATGAATTTGGACATCCTGANTGGATANATTTTCCAA
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0005975 biological_process carbohydrate metabolic process
GO:0003824 molecular_function catalytic activity
GO:0043169 molecular_function cation binding

KEGG Analysis

Analysis Date: 01-18-2011 (KEGG analysis for Vaccinium corymbosum unigene v1)
K00700 E2.4.1.18, glgB; 1,4-alpha-glucan branching enzyme [EC:2.4.1.18]

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CF810648_3_ORF1 CRC64: F8056F5E73B5BFA6 LENGTH: 119 aa
InterPro
IPR013781
Domain
Glycoside hydrolase, subgroup, catalytic core
G3DSA:3.20.20.80 [5-115]T 2.7e-07 G3DSA:3.20.20.80 no description no description
InterPro
IPR017853
Domain
Glycoside hydrolase, catalytic core
SSF51445 [1-113]T 3.8e-13 SSF51445 (Trans)glycosidases (Trans)glycosidases
noIPR
unintegrated
unintegrated
PTHR10357 [1-119]T 1.5e-85 PTHR10357 AMYLASE AMYLASE
PTHR10357:SF27 [1-119]T 1.5e-85 PTHR10357:SF27 STARCH BRANCHING ENZYME STARCH BRANCHING ENZYME

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CF810648
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0006s116204.18e-6594.12%POPTR_0006s11620.2
HSP 1
Score: 242.662 bits (618), Expect = 4.18459e-65
Identity = 112/119 (94.12%), Postives = 116/119 (97.48%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMAIADKWIELL+K+DEDWR+GDIV+TLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMI LITMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 228 YRLHMAIADKWIELLQKKDEDWRMGDIVHTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFP 346

POPTR_0006s116204.18e-6594.12%POPTR_0006s11620.1
HSP 1
Score: 242.662 bits (618), Expect = 4.18459e-65
Identity = 112/119 (94.12%), Postives = 116/119 (97.48%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMAIADKWIELL+K+DEDWR+GDIV+TLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMI LITMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 228 YRLHMAIADKWIELLQKKDEDWRMGDIVHTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFP 346

POPTR_0005s272402.02e-4369.17%POPTR_0005s27240.1
HSP 1
Score: 170.629 bits (431), Expect = 2.02089e-43
Identity = 83/120 (69.17%), Postives = 95/120 (79.17%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLK-KRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRL MAI DKWI+ LK K D +W + +I +LTNRR+ EKCV+YAESHDQ++VGDKTIAF LMDK+MY M+ + P VDRGIALHKMI ITM LGGEGYLNFMGNEFGHP WI FP
Sbjct: 501 YRLAMAIPDKWIDYLKNKSDLEWSMNEISRSLTNRRYTEKCVAYAESHDQSIVGDKTIAFILMDKEMYSGMSCLTEAPPAVDRGIALHKMIHFITMALGGEGYLNFMGNEFGHPEWIDFP 620

POPTR_0001s369602.11e-1641.44%POPTR_0001s36960.1
HSP 1
Score: 80.8777 bits (198), Expect = 2.10589e-16
Identity = 46/111 (41.44%), Postives = 63/111 (56.76%), Query Frame = 3
Query:   33 WIELLKK-RDEDWRVGDIVYTLT-NRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
W LK D +W + IV L NR++ +K + YAE+H+Q + G ++ A L + ST + RG +LHKMI +IT +GG YLNFMGNEFGHP + FP
Sbjct: 2 WTSFLKNIPDHEWSMSKIVSALMGNRQYADKMLIYAENHNQCISGGQSFAEILFG----EINEHTPGSTESLLRGCSLHKMIRMITFTIGGRAYLNFMGNEFGHPKRVEFP 108

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CF810648
Best 10 Hits Shown

Match Name E value Identity Description
ppa001312m 2.36e-6289.92%ppa001312m
HSP 1
Score: 233.032 bits (593), Expect = 2.36156e-62
Identity = 107/119 (89.92%), Postives = 114/119 (95.80%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMAIADKWIELL+K DE+W++GDIV+TLTNRRW EKCV+YAESHDQALVGDKTIAFWLMDKDMYDFMALDRP+TPLVDRGIALHKMI LITMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 575 YRLHMAIADKWIELLQKIDEEWQMGDIVHTLTNRRWREKCVAYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPATPLVDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFP 693

ppa001929m 1.30e-4466.67%ppa001929m
HSP 1
Score: 174.096 bits (440), Expect = 1.30186e-44
Identity = 80/120 (66.67%), Postives = 98/120 (81.67%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLK-KRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRL MAI DKWI+ LK K DE+W + +I +LTNRR+ EKC+SYAESHDQA+VGDKTIAF+LMD++MY M+ ++P ++RGIALHKMI +TM LGGEGYLNFMGNEFGHP W+ FP
Sbjct: 418 YRLAMAIPDKWIDYLKNKNDEEWSMNEISCSLTNRRYTEKCISYAESHDQAIVGDKTIAFFLMDREMYSGMSCLTDASPTIERGIALHKMIHFLTMALGGEGYLNFMGNEFGHPEWVDFP 537

ppa016544m 1.04e-1740.00%ppa016544m
HSP 1
Score: 84.7297 bits (208), Expect = 1.03872e-17
Identity = 46/115 (40.00%), Postives = 71/115 (61.74%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKK-RDEDWRVGDIVYTLT-NRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHP 341
Y +++++++ W L+ D DW + IV TL NR++ +K + YAE+H+Q++ G ++ A L + + L+ RG +LHKMI LIT+ +GG YLNFMGNEFGHP
Sbjct: 628 YCVNLSVSEMWSSFLETVPDHDWSMTKIVNTLMGNRKFADKTLVYAENHNQSISGGRSFAEILFG----EIRDGSHDTEKLLLRGCSLHKMIRLITLTIGGRAYLNFMGNEFGHP 738

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CF810648
Best 10 Hits Shown

Match Name E value Identity Description
GLGB_MAIZE8.02e-6187.39%
1,4-alpha-glucan-branching enzyme 2, chl...
HSP 1
Score: 231.876 bits (590), Expect = 8.02486e-61
Identity = 104/119 (87.39%), Postives = 113/119 (94.96%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YR+HMA+ADKWI+LLK+ DE W++GDIV+TLTNRRWLEKCV+YAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTP +DRGIALHKMI LITMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 523 YRMHMAVADKWIDLLKQSDETWKMGDIVHTLTNRRWLEKCVTYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPTIDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFP 641

GLGB_MOUSE4.88e-5075.83%
1,4-alpha-glucan-branching enzyme OS=Mus...
HSP 1
Score: 196.052 bits (497), Expect = 4.87982e-50
Identity = 91/120 (75.83%), Postives = 105/120 (87.50%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKK-RDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRL MAI DKWI+LLK+ +DEDW +G+IVYTLTNRR+LEKCV+YAESHDQALVGDKT+AFWLMD +MY M++ P TP++DRGI LHKMI LIT GLGGEGYLNFMGNEFGHP W+ FP
Sbjct: 433 YRLAMAIPDKWIQLLKEFKDEDWNMGNIVYTLTNRRYLEKCVAYAESHDQALVGDKTLAFWLMDAEMYTNMSVLAPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFP 552

GLGB_HUMAN4.88e-5075.00%
1,4-alpha-glucan-branching enzyme OS=Hom...
HSP 1
Score: 196.052 bits (497), Expect = 4.87982e-50
Identity = 90/120 (75.00%), Postives = 105/120 (87.50%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKK-RDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRL MAI DKWI+LLK+ +DEDW +GDIVYTLTNRR+LEKC++YAESHDQALVGDK++AFWLMD +MY M++ P TP++DRGI LHKMI LIT GLGGEGYLNFMGNEFGHP W+ FP
Sbjct: 433 YRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFP 552

GLGB_FELCA3.16e-4974.17%
1,4-alpha-glucan-branching enzyme OS=Fel...
HSP 1
Score: 193.356 bits (490), Expect = 3.16301e-49
Identity = 89/120 (74.17%), Postives = 104/120 (86.67%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKK-RDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRL MAI DKWI+LLK+ +DEDW +G+IVYTLTNRR+LEKC++YAESHDQALVGDKT+AFWLMD +MY M++ P TP++DRGI LHKMI LIT LGGEGYLNFMGNEFGHP W+ FP
Sbjct: 430 YRLAMAIPDKWIQLLKEFKDEDWNMGNIVYTLTNRRYLEKCIAYAESHDQALVGDKTLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHALGGEGYLNFMGNEFGHPEWLDFP 549

GLGB_HORSE5.97e-4872.50%
1,4-alpha-glucan-branching enzyme OS=Equ...
HSP 1
Score: 189.119 bits (479), Expect = 5.96518e-48
Identity = 87/120 (72.50%), Postives = 103/120 (85.83%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKK-RDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRL MAI DKWI+L+K+ +DEDW +G+IVYTLTNRR LEKC++YAESHDQALVGDK++AFWLMD +MY M++ P TP++DRGI LHKMI LIT LGGEGYLNFMGNEFGHP W+ FP
Sbjct: 430 YRLAMAIPDKWIQLVKEFKDEDWNMGNIVYTLTNRRHLEKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHALGGEGYLNFMGNEFGHPEWLDFP 549

GLGB_YARLI1.05e-4470.00%
1,4-alpha-glucan-branching enzyme OS=Yar...
HSP 1
Score: 178.333 bits (451), Expect = 1.05295e-44
Identity = 84/120 (70.00%), Postives = 99/120 (82.50%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKK-RDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRL MAI D WI+L+K+ RDEDW +G+IV+TLTNRR EK ++YAESHDQALVGDKT+AFWLMDK+MY M++ P++DRGIALHKMI LIT LGGEGYLNF GNEFGHP W+ FP
Sbjct: 419 YRLAMAIPDMWIKLVKETRDEDWDMGNIVFTLTNRRHREKTIAYAESHDQALVGDKTLAFWLMDKEMYTSMSVLSDPNPIIDRGIALHKMIRLITHSLGGEGYLNFEGNEFGHPEWLDFP 538

GLGB_DEBHA1.05e-4469.17%
1,4-alpha-glucan-branching enzyme OS=Deb...
HSP 1
Score: 178.333 bits (451), Expect = 1.05295e-44
Identity = 83/120 (69.17%), Postives = 97/120 (80.83%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKK-RDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRL MAI D WI+++K DE+W +G +V+TLTNRR E+C+SY ESHDQALVGDKTIAFWLMDK+MY M+ P TP++DRGIALHKMI LIT LGGEGYLNF GNEFGHP W+ FP
Sbjct: 435 YRLSMAIPDMWIKIIKHLSDEEWDMGSLVHTLTNRRHGERCISYCESHDQALVGDKTIAFWLMDKEMYTNMSTLTPFTPVIDRGIALHKMIRLITFSLGGEGYLNFEGNEFGHPEWLDFP 554

GLGB_DICDI1.38e-4466.67%
1,4-alpha-glucan-branching enzyme OS=Dic...
HSP 1
Score: 177.948 bits (450), Expect = 1.3752e-44
Identity = 80/120 (66.67%), Postives = 99/120 (82.50%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLK-KRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRL M I DKWIEL+K K+DEDW +G I + L+NRR+ EK ++YAESHDQ+LVGDKT+AFWLMDK+MY M++ TP++DRG++LHKMI LIT LGG+GYLNFMGNEFGHP W+ FP
Sbjct: 412 YRLAMGIPDKWIELVKEKKDEDWNMGTIAHMLSNRRYKEKNIAYAESHDQSLVGDKTLAFWLMDKEMYTNMSVTTEETPIIDRGMSLHKMIRLITSSLGGDGYLNFMGNEFGHPEWVDFP 531

GLGB_CRYNE6.83e-4469.17%
1,4-alpha-glucan-branching enzyme OS=Cry...
HSP 1
Score: 175.637 bits (444), Expect = 6.82504e-44
Identity = 83/120 (69.17%), Postives = 96/120 (80.00%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKK-RDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRL MAI D WI+LLK+ D+ W +G IV+ LTNRR LEK V+YAESHDQALVGDKT+AFWLMDK+MYDFM+ P TP++DRG+ALHKMI I LGGE YLNF GNEFGHP W+ FP
Sbjct: 418 YRLSMAIPDMWIKLLKEYTDDQWEMGQIVHNLTNRRHLEKSVAYAESHDQALVGDKTLAFWLMDKEMYDFMSDLSPLTPIIDRGLALHKMIRFIVHTLGGEAYLNFEGNEFGHPEWMDFP 537

GLGB_SOLTU8.91e-4468.33%
1,4-alpha-glucan-branching enzyme OS=Sol...
HSP 1
Score: 175.252 bits (443), Expect = 8.91378e-44
Identity = 82/120 (68.33%), Postives = 97/120 (80.83%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLK-KRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRL MAI DKWI+ LK K DEDW + ++ +LTNRR+ EKC++YAESHDQ++VGDKTIAF LMDK+MY M+ ++P+VDRGIALHKMI TM LGGEGYLNFMGNEFGHP WI FP
Sbjct: 505 YRLAMAIPDKWIDYLKNKNDEDWSMKEVTSSLTNRRYTEKCIAYAESHDQSIVGDKTIAFLLMDKEMYSGMSCLTDASPVVDRGIALHKMIHFFTMALGGEGYLNFMGNEFGHPEWIDFP 624

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CF810648
Best 10 Hits Shown

Match Name E value Identity Description
B9MTP9_POPTR9.32e-6394.12%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 242.662 bits (618), Expect = 9.31921e-63
Identity = 112/119 (94.12%), Postives = 116/119 (97.48%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMAIADKWIELL+K+DEDWR+GDIV+TLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMI LITMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 446 YRLHMAIADKWIELLQKKDEDWRMGDIVHTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFP 564

A2TIS1_POPTR9.32e-6394.12%
Starch branching enzyme II OS=Populus tr...
HSP 1
Score: 242.662 bits (618), Expect = 9.31921e-63
Identity = 112/119 (94.12%), Postives = 116/119 (97.48%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMAIADKWIELL+K+DEDWR+GDIV+TLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMI LITMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 549 YRLHMAIADKWIELLQKKDEDWRMGDIVHTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFP 667

Q9XGA7_SOLTU4.63e-6293.28%
Starch branching enzyme II (Fragment) OS...
HSP 1
Score: 240.35 bits (612), Expect = 4.62508e-62
Identity = 111/119 (93.28%), Postives = 114/119 (95.80%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMAIADKWIELLKKRDEDWRVGDIV+TLTNRRW EKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPST L+DRGIALHKMI L+TMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 537 YRLHMAIADKWIELLKKRDEDWRVGDIVHTLTNRRWSEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTSLIDRGIALHKMIRLVTMGLGGEGYLNFMGNEFGHPEWIDFP 655

Q9XGA6_SOLTU4.63e-6293.28%
Starch branching enzyme II OS=Solanum tu...
HSP 1
Score: 240.35 bits (612), Expect = 4.62508e-62
Identity = 111/119 (93.28%), Postives = 114/119 (95.80%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMAIADKWIELLKKRDEDWRVGDIV+TLTNRRW EKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPST L+DRGIALHKMI L+TMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 582 YRLHMAIADKWIELLKKRDEDWRVGDIVHTLTNRRWSEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTSLIDRGIALHKMIRLVTMGLGGEGYLNFMGNEFGHPEWIDFP 700

Q9XGA5_SOLTU4.63e-6293.28%
Starch branching enzyme II OS=Solanum tu...
HSP 1
Score: 240.35 bits (612), Expect = 4.62508e-62
Identity = 111/119 (93.28%), Postives = 114/119 (95.80%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMAIADKWIELLKKRDEDWRVGDIV+TLTNRRW EKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPST L+DRGIALHKMI L+TMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 582 YRLHMAIADKWIELLKKRDEDWRVGDIVHTLTNRRWSEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTSLIDRGIALHKMIRLVTMGLGGEGYLNFMGNEFGHPEWIDFP 700

Q9LZS3_ARATH4.63e-6290.76%
1, 4-alpha-glucan branching enzyme prote...
HSP 1
Score: 240.35 bits (612), Expect = 4.62508e-62
Identity = 108/119 (90.76%), Postives = 115/119 (96.64%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMAIADKWIE+LKKRDEDW++GDI+YTLTNRRW EKC+SYAESHDQALVGDKTIAFWLMDKDMYDFMA+DRPSTPL+DRGIALHKMI LITMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 527 YRLHMAIADKWIEMLKKRDEDWQMGDIIYTLTNRRWSEKCISYAESHDQALVGDKTIAFWLMDKDMYDFMAVDRPSTPLIDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFP 645

Q42531_ARATH4.63e-6290.76%
Starch branching enzyme class II (Fragme...
HSP 1
Score: 240.35 bits (612), Expect = 4.62508e-62
Identity = 108/119 (90.76%), Postives = 115/119 (96.64%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMAIADKWIE+LKKRDEDW++GDI+YTLTNRRW EKC+SYAESHDQALVGDKTIAFWLMDKDMYDFMA+DRPSTPL+DRGIALHKMI LITMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 522 YRLHMAIADKWIEMLKKRDEDWQMGDIIYTLTNRRWSEKCISYAESHDQALVGDKTIAFWLMDKDMYDFMAVDRPSTPLIDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFP 640

O49953_SOLTU4.63e-6293.28%
Starch branching enzyme II, SBE-II (Frag...
HSP 1
Score: 240.35 bits (612), Expect = 4.62508e-62
Identity = 111/119 (93.28%), Postives = 114/119 (95.80%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMAIADKWIELLKKRDEDWRVGDIV+TLTNRRW EKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPST L+DRGIALHKMI L+TMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 534 YRLHMAIADKWIELLKKRDEDWRVGDIVHTLTNRRWSEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTSLIDRGIALHKMIRLVTMGLGGEGYLNFMGNEFGHPEWIDFP 652

Q41058_PEA6.04e-6291.60%
Starch branching enzyme I OS=Pisum sativ...
HSP 1
Score: 239.965 bits (611), Expect = 6.04054e-62
Identity = 109/119 (91.60%), Postives = 115/119 (96.64%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMA+ADKWIELLKK+DEDWR+GDIV+TLTNRRWLEKCV YAESHDQALVGDKT+AFWLMDKDMYDFMALDRPSTPL+DRGIALHKMI LITMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 570 YRLHMAVADKWIELLKKQDEDWRMGDIVHTLTNRRWLEKCVVYAESHDQALVGDKTLAFWLMDKDMYDFMALDRPSTPLIDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFP 688

D7LWS4_ARALY1.03e-6189.92%
1, 4-alpha-glucan branching enzyme prote...
HSP 1
Score: 239.195 bits (609), Expect = 1.03036e-61
Identity = 107/119 (89.92%), Postives = 115/119 (96.64%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMAIADKWIE+LKKRDEDW++GDI+YTLTNRRW EKC++YAESHDQALVGDKTIAFWLMDKDMYDFMA+DRPSTPL+DRGIALHKMI LITMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 538 YRLHMAIADKWIEILKKRDEDWQMGDIIYTLTNRRWSEKCIAYAESHDQALVGDKTIAFWLMDKDMYDFMAVDRPSTPLIDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFP 656

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CF810648
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010338010016.01e-6288.24%GSVIVT01033801001 assembled CDS
HSP 1
Score: 231.491 bits (589), Expect = 6.01471e-62
Identity = 105/119 (88.24%), Postives = 113/119 (94.96%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMAIADKWIELLKK DE W++GDI++TLTNRRWLEKCV+YAESHDQALVGDKTIAFWLMDKDMY+FMALDRP+TP +DRGIALHKMI LITMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 576 YRLHMAIADKWIELLKKPDEYWKMGDIIHTLTNRRWLEKCVAYAESHDQALVGDKTIAFWLMDKDMYEFMALDRPTTPAIDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFP 694

GSVIVT010086730016.68e-4569.17%GSVIVT01008673001 assembled CDS
HSP 1
Score: 174.866 bits (442), Expect = 6.68096e-45
Identity = 83/120 (69.17%), Postives = 98/120 (81.67%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLK-KRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRL MAI DKWI+ LK K+DE+W + +I +LTNRR+ EKC+SYAESHDQALVGDKTIAF LMDK+MY M+ ++P +DRGI+LHKMI ITM LGGEG+LNFMGNEFGHP WI FP
Sbjct: 505 YRLAMAIPDKWIDYLKNKKDEEWSMKEISSSLTNRRYAEKCISYAESHDQALVGDKTIAFLLMDKEMYSGMSCLTDASPTIDRGISLHKMIHFITMALGGEGFLNFMGNEFGHPEWIDFP 624

GSVIVT010376950017.44e-2041.32%GSVIVT01037695001 assembled CDS
HSP 1
Score: 91.6633 bits (226), Expect = 7.43824e-20
Identity = 50/121 (41.32%), Postives = 75/121 (61.98%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKK-RDEDWRVGDIVYTLT-NRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
Y ++++ D W++ L+ D +W + IV TL NR++ +K + YAE+H+Q++ G ++ A L D ++ S + RG +LHKMI LIT+ +GG YLNFMGNEFGHP I FP
Sbjct: 630 YYVNLSAPDMWLDFLENIPDHEWSMSKIVSTLIGNRQYADKMLVYAENHNQSISGGRSFAEILFGAIKEDPLS----SKTTLLRGCSLHKMIRLITLTIGGHAYLNFMGNEFGHPKRIEFP 746

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CF810648
Best 10 Hits Shown

Match Name E value Identity Description
AT5G03650.1 1.80e-6490.76%
starch branching enzyme 2.2 | chr5:9319...
HSP 1
Score: 240.35 bits (612), Expect = 1.80013e-64
Identity = 108/119 (90.76%), Postives = 115/119 (96.64%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMAIADKWIE+LKKRDEDW++GDI+YTLTNRRW EKC+SYAESHDQALVGDKTIAFWLMDKDMYDFMA+DRPSTPL+DRGIALHKMI LITMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 527 YRLHMAIADKWIEMLKKRDEDWQMGDIIYTLTNRRWSEKCISYAESHDQALVGDKTIAFWLMDKDMYDFMAVDRPSTPLIDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFP 645

AT2G36390.1 1.86e-6189.08%
starch branching enzyme 2.1 | chr2:1526...
HSP 1
Score: 230.335 bits (586), Expect = 1.86284e-61
Identity = 106/119 (89.08%), Postives = 111/119 (93.28%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKKRDEDWRVGDIVYTLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
YRLHMA+ADKWIELLKKRDEDW+VGDI +TLTNRRW EKCV YAESHDQALVGDKTIAFWLMDKDMYDFMA+DR +TP VDRGIALHKMI LITMGLGGEGYLNFMGNEFGHP WI FP
Sbjct: 562 YRLHMAVADKWIELLKKRDEDWQVGDITFTLTNRRWGEKCVVYAESHDQALVGDKTIAFWLMDKDMYDFMAVDRQATPRVDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFP 680

AT3G20440.3 9.35e-2142.74%
Alpha amylase family protein | chr3:712...
HSP 1
Score: 95.1301 bits (235), Expect = 9.35302e-21
Identity = 53/124 (42.74%), Postives = 76/124 (61.29%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKK-RDEDWRVGDIVYTLT-NRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPST---PLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
Y ++++ ++ W+ LL D +W + IV TL N+ + +K +SYAE+H+Q++ G ++ A L F +D S L+DRGI+LHKMI LIT GG YLNFMGNEFGHP + FP
Sbjct: 638 YYVNLSASEMWVSLLDNVPDNEWSMSKIVSTLVANKEYADKMLSYAENHNQSISGGRSFAEIL-------FGGVDNGSPGGKELLDRGISLHKMIRLITFTSGGRAYLNFMGNEFGHPERVEFP 754

AT3G20440.2 9.35e-2142.74%
Alpha amylase family protein | chr3:712...
HSP 1
Score: 95.1301 bits (235), Expect = 9.35302e-21
Identity = 53/124 (42.74%), Postives = 76/124 (61.29%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKK-RDEDWRVGDIVYTLT-NRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPST---PLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
Y ++++ ++ W+ LL D +W + IV TL N+ + +K +SYAE+H+Q++ G ++ A L F +D S L+DRGI+LHKMI LIT GG YLNFMGNEFGHP + FP
Sbjct: 633 YYVNLSASEMWVSLLDNVPDNEWSMSKIVSTLVANKEYADKMLSYAENHNQSISGGRSFAEIL-------FGGVDNGSPGGKELLDRGISLHKMIRLITFTSGGRAYLNFMGNEFGHPERVEFP 749

AT3G20440.1 9.35e-2142.74%
Alpha amylase family protein | chr3:712...
HSP 1
Score: 95.1301 bits (235), Expect = 9.35302e-21
Identity = 53/124 (42.74%), Postives = 76/124 (61.29%), Query Frame = 3
Query:    3 YRLHMAIADKWIELLKK-RDEDWRVGDIVYTLT-NRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPST---PLVDRGIALHKMIXLITMGLGGEGYLNFMGNEFGHPXWIXFP 359
Y ++++ ++ W+ LL D +W + IV TL N+ + +K +SYAE+H+Q++ G ++ A L F +D S L+DRGI+LHKMI LIT GG YLNFMGNEFGHP + FP
Sbjct: 603 YYVNLSASEMWVSLLDNVPDNEWSMSKIVSTLVANKEYADKMLSYAENHNQSISGGRSFAEIL-------FGGVDNGSPGGKELLDRGISLHKMIRLITFTSGGRAYLNFMGNEFGHPERVEFP 719

Related info for CF810648