CF811171

Information for CF811171

NameCF811171
AccessionID1872
Length627 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014531 cDNA non acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CF811171
Sequence
CACTCCTACCTGGCTTCCAGGGCGGCGTGGATGACAGTGGCGCTGCAGCTGTGAGAACTA
TTATGCATTGGCAATATCGAACAATATGCAGAGGACAGTATTCGATATTGCATAATCTCT
CTGTTCTTCTGGGGCCAAAGTTGCATGATTACATATCTTTCTATGGCCTTAGAGCTTATG
GAAGACTTTTTGAGGGTGGTCCTGTGGCAACCAGTCAGGTGTATGTGCATAGCAAAATCA
TGATAATTGATGACCGTTTGTCCTTGATAGGATCAGCTAATATAAATGACAGGAGTTTGC
TTGGGTCAAGAGATTCTGAGATTGGTGTACTTATTGAAGACAGAGAGTTTGTTGATTCGT
GTATGGGAGGGAAGCCTTGGAAAGCAGGGAAATTTGCTTCGAGTCTTCGCCTTGCCCTAT
GGTCTGAACACCTTGGTCTTTCTGCCGCAGAGATTAATCAAATAAAAGACCCTGTTGTTG
ATGCAACTTACAAAGATATATGGATGGCAACTGCTAAGACAAATACAATGATCTACCAAG
ATGTCTTTTCCTGTATCCCAAATGATCTAATACATTCCAGATCCCTCACTGAGACAATCC
ACAACCTACTGGAAGGAAAAAACTNAB
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0008152 biological_process metabolic process
GO:0003824 molecular_function catalytic activity

KEGG Analysis

Analysis Date: 01-18-2011 (KEGG analysis for Vaccinium corymbosum unigene v1)
K01115 E3.1.4.4, PLD; phospholipase D [EC:3.1.4.4]

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CF811171_3_ORF1 CRC64: 00AACC5D93AE1BAD LENGTH: 207 aa
InterPro
IPR001736
Domain
Phospholipase D/Transphosphatidylase
PF00614 [75-98]T 9.2e-09 PF00614 PLDc PLDc
SM00155 [71-98]T 1e-07 SM00155 no description no description
PS50035 [71-98]T 15.418 PS50035 PLD PLD
InterPro
IPR015679
Family
Phospholipase D
PTHR18896 [1-193]T 5.4e-132 PTHR18896 PHOSPHOLIPASE D PHOSPHOLIPASE D
noIPR
unintegrated
unintegrated
G3DSA:3.30.870.10 [43-119]T 8.7e-13 G3DSA:3.30.870.10 no description no description
PTHR18896:SF2 [1-193]T 5.4e-132 PTHR18896:SF2 PHOSPHOLIPASE D ZETA PHOSPHOLIPASE D ZETA
SSF56024 [65-147]T 5e-19 SSF56024 Phospholipase D/nuclease Phospholipase D/nuclease
SEQUENCE: CF811171_5_ORF2 CRC64: 5409EA8015A8C1B1 LENGTH: 80 aa
noIPR
unintegrated
unintegrated
seg [34-50]? NA seg seg seg

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CF811171
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0008s232407.13e-9383.51%POPTR_0008s23240.1
HSP 1
Score: 336.65 bits (862), Expect = 7.129e-93
Identity = 162/194 (83.51%), Postives = 177/194 (91.24%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRS 584
LLPGFQGGVDD GAA+VR IMHWQYRTICRGQ SILHNL LGPK HDYISFYGLR+YGRLF+GGPVATSQVYVHSKIMIIDDR +LIGSANINDRSLLGSRDSEIGVLIED+E VDS MGGKP KAGKF SLRL+LWSEHLGL + IN++ DPV+D+TYKDIWM+TAKTNTMIYQDVFSC+PNDLIH+R+
Sbjct: 867 LLPGFQGGVDDGGAASVRAIMHWQYRTICRGQNSILHNLYDHLGPKTHDYISFYGLRSYGRLFDGGPVATSQVYVHSKIMIIDDRTTLIGSANINDRSLLGSRDSEIGVLIEDKELVDSLMGGKPRKAGKFTLSLRLSLWSEHLGLHSKAINKVIDPVIDSTYKDIWMSTAKTNTMIYQDVFSCVPNDLIHTRA 1060

POPTR_0010s008502.93e-9281.96%POPTR_0010s00850.1
HSP 1
Score: 334.339 bits (856), Expect = 2.92737e-92
Identity = 159/194 (81.96%), Postives = 177/194 (91.24%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRS 584
LLPGFQGGVDD GAA+VR IMHWQYRTICRGQ S+LHNL LLGPK DYISFYGLRAYG+L GGPV TSQVYVHSKIMI+DDR +LIGSANINDRSLLGSRDSEIGVLIED+EFVDS MGGKPWKAGKFA SLRL+LWSEHLGL A EI+++ DPV+++TYKD WM+TAKTNTMIYQDVFSC+P+DLIH+R+
Sbjct: 705 LLPGFQGGVDDGGAASVRAIMHWQYRTICRGQNSVLHNLYDLLGPKTQDYISFYGLRAYGQLSNGGPVVTSQVYVHSKIMIVDDRATLIGSANINDRSLLGSRDSEIGVLIEDKEFVDSLMGGKPWKAGKFALSLRLSLWSEHLGLHAKEIHKVIDPVIESTYKDRWMSTAKTNTMIYQDVFSCVPSDLIHTRA 898

HSP 2
Score: 22.7126 bits (47), Expect = 2.92737e-92
Identity = 7/12 (58.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  586 SLRQSTTYWKEK 621
+LRQST +WK++
Sbjct: 899 ALRQSTAFWKDR 910

POPTR_0013s013801.45e-8272.68%POPTR_0013s01380.1
HSP 1
Score: 302.368 bits (773), Expect = 1.4503e-82
Identity = 141/194 (72.68%), Postives = 167/194 (86.08%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRS 584
L PGFQGGVDD GAA VR IMHWQYRTI R + SIL+NL+ LLGPK HDYISF GLR YGRLF GGP+ TSQVYVHSK+MI+DDR++ IGS+NINDRSLLGSRDSEIG++ ED+EFV+S M G+ WKAGKFA SLR +LWSEHLGLS+ EI++I DPV + TY+D+W+ATAK N+ IYQDVF+C+PND IHSR+
Sbjct: 836 LSPGFQGGVDDGGAATVRAIMHWQYRTISRKKTSILYNLNTLLGPKTHDYISFCGLRTYGRLFVGGPLVTSQVYVHSKVMIVDDRIAYIGSSNINDRSLLGSRDSEIGIVTEDKEFVESSMNGETWKAGKFAYSLRRSLWSEHLGLSSGEIDKISDPVAETTYRDLWLATAKENSKIYQDVFACLPNDHIHSRA 1029

HSP 2
Score: 22.3274 bits (46), Expect = 1.4503e-82
Identity = 8/12 (66.67%), Postives = 10/12 (83.33%), Query Frame = 1
Query:  586 SLRQSTTYWKEK 621
+LRQS +WKEK
Sbjct: 1030 ALRQSMNHWKEK 1041

POPTR_0006s270001.38e-1132.76%POPTR_0006s27000.1
HSP 1
Score: 66.6254 bits (161), Expect = 1.37602e-11
Identity = 57/174 (32.76%), Postives = 85/174 (48.85%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKL--HDYISFY--GLRAYGRLFEGGPVATSQ---------------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASS---------LRLALWSEHLGL 440
++P + G+ +SG+ V+ I+ WQ RT+ YS + V G +Y++F+ G R ++ E P + +YVH+K+MI+DD +IGSANIN RS+ GSRDSEI MGG ++ A+S R+ALW EHLG+
Sbjct: 531 VIPMWPEGLPESGS--VQAILDWQRRTMDM-MYSDITEALVKKGLNTDPREYLAFFCLGNRETKKIGEYAPPEEPEPDTDYSRARQARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGSRDSEI------------AMGG--YQPHHLATSQPARGQIYGFRMALWYEHLGM 687

POPTR_0018s131102.35e-1130.72%POPTR_0018s13110.1
HSP 1
Score: 65.855 bits (159), Expect = 2.34713e-11
Identity = 51/166 (30.72%), Postives = 82/166 (49.40%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYS----ILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQ-----------------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLG 437
++P + G+ +SG+ V+ I++WQ RT+ YS L + V PK DY++F+ L + R G V + + +Y+H+K+MI+DD + GSANIN RS+ G RD+EI + + + + G R++LW EHLG
Sbjct: 568 VIPMWPEGIPESGS--VQAILNWQKRTM-EMMYSDIAEALQDKGVEANPK--DYLTFFCLGKHEREMPGEYVPSERPEHNSDYSRAQKARRFMIYIHAKMMIVDDEYIITGSANINQRSMDGGRDTEIAMGAYQPYHLATNQPARGQIHG-----FRMSLWYEHLG 723

POPTR_0003s029902.35e-1132.12%POPTR_0003s02990.1
HSP 1
Score: 65.855 bits (159), Expect = 2.34713e-11
Identity = 53/165 (32.12%), Postives = 80/165 (48.48%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLH--DYISFYGLRAYGRLFEG------GPVATSQ-----------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGL 440
L+P + GV DS V+ I+HW +T+ Y ++ G H DY++F+ L +G P ++Q VYVHSK+MI+DD LIGSAN+N RS+ G RD+EI + + G+ + + + R++LW EH GL
Sbjct: 519 LMPMWPEGVPDS--EPVQDILHWTRQTMAM-MYKLVGEALQESGEPGHPRDYLNFFCLANREEENKGELVPPYSPHPSTQYWNAQKHRRFMVYVHSKLMIVDDAYMLIGSANVNQRSMDGRRDTEIAIGCYQPK------NGENTRNPRDILAYRMSLWYEHTGL 674

POPTR_0002s017506.83e-1133.96%POPTR_0002s01750.1
HSP 1
Score: 64.3142 bits (155), Expect = 6.82911e-11
Identity = 54/159 (33.96%), Postives = 79/159 (49.69%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLH--DYISFYGL----RAYGRLFEGGP-VATSQ------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGL 440
++P + GV S A+V+ I+ WQ +T+ I + L + H DY++FY L G G V+ SQ +YVH+K M++DD ++GSANIN RS+ GSRD+EI + S P R++LW+EHLGL
Sbjct: 559 VIPMWPEGVPTS--ASVQEILFWQGQTMQMMYEVIANELKSMNLENSHPQDYLNFYCLGNREEVPGSNNSGDQTVSMSQKFQRFMIYVHAKGMVVDDEYVILGSANINQRSMAGSRDTEIAMGAYQPHHTWSNKKRHPLGQ---VYGYRMSLWAEHLGL 712

POPTR_0003s027301.16e-1029.95%POPTR_0003s02730.1
HSP 1
Score: 63.5438 bits (153), Expect = 1.16487e-10
Identity = 59/197 (29.95%), Postives = 88/197 (44.67%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVL-LGPKLHDYISFY--GLRAYGRLFEGGPVATSQ---------------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGG-KPW------KAGKFASSLRLALWSEHLGL------------SAAEINQIKDPVVD 482
++P + G+ +SG+ V+ I+ WQ RT+ ++ L L +Y++F+ G R + E P + +YVH+K+MI+DD +IGSANIN RS+ G+RDSEI MGG +P+ A RL LW EHLG+ ++NQI D D
Sbjct: 483 VVPMWPEGIPESGS--VQAILDWQRRTLEMMYKDVIEALRAKGLEEDPRNYLTFFCLGNREVKKSGEYEPSEKPEPDSDYIRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEI------------AMGGYQPYHLATRQPARGQIHGFRLGLWYEHLGMLDDTFLHPESEECVTKVNQITDKYWD 665

POPTR_0001s193602.60e-1031.58%POPTR_0001s19360.1
HSP 1
Score: 62.3882 bits (150), Expect = 2.59506e-10
Identity = 54/171 (31.58%), Postives = 81/171 (47.37%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVL-LGPKLHDYISFY--GLRAYGRLFEGGPVATSQ---------------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGG-KPW------KAGKFASSLRLALWSEHLGL 440
++P + G+ +S A+V+ I+ WQ RT+ ++ L L +Y++F+ G R + E P + +YVH+K+MI+DD +IGSANIN RS+ G+RDSEI MGG +P+ A RL LW EHLG+
Sbjct: 483 VVPMWPEGIPES--ASVQAILDWQRRTMDMMYKDVIQALRAKGLEEDPRNYLTFFCLGNREVKKSGEYEPSEKPEPDSDYIRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEI------------AMGGYQPYHLATRQPARGQIHGFRLGLWYEHLGM 639

POPTR_0005s107704.43e-1031.17%POPTR_0005s10770.1
HSP 1
Score: 61.6178 bits (148), Expect = 4.4265e-10
Identity = 48/154 (31.17%), Postives = 71/154 (46.10%), Query Frame = 3
Query:   33 DSGAAAVRTIMHWQYRTICRGQYSILHNLSV--LLGPKLHDYISFYGLRAYGRLFE------GGPVATS------QVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGK-----FASSLRLALWSEHLG 437
D V+ I+ WQ +T+ I L L+ DY++FY + + + GG V+ S +YVH+K M++DD ++GSANIN RS+ GS+D+EI + S W A K R++LW EHLG
Sbjct: 387 DPKTNTVQEILFWQSQTMQAMYEKIAQELKSMNLVDSHPQDYLNFYCIGKREEIPQELSSANGGTVSESFKSQRFMIYVHAKGMVVDDEYVIMGSANINQRSMAGSKDTEIA--------MGSYQPRHTWAARKKHPRGQIYGYRMSLWVEHLG 532

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CF811171
Best 10 Hits Shown

Match Name E value Identity Description
ppa000537m 5.65e-9280.41%ppa000537m
HSP 1
Score: 333.183 bits (853), Expect = 5.64621e-92
Identity = 156/194 (80.41%), Postives = 178/194 (91.75%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRS 584
L+PGFQGG+DD+GAA+VR +MHWQYRTICRGQ+SIL NL+ +LGPK HDYISFYGLR+YG+LF+GGPVA SQVYVHSKIMIIDD +LIGSANINDRSLLGSRDSEIG+LIED+E ++S MGGKPWKAGKF+ SLRL+LWSEHLG+ A E+NQI DPVVD+TYKDIWMATAK NT IYQDVFSCIPND IHSR+
Sbjct: 834 LIPGFQGGLDDAGAASVRAVMHWQYRTICRGQFSILQNLNEILGPKTHDYISFYGLRSYGKLFDGGPVACSQVYVHSKIMIIDDCTTLIGSANINDRSLLGSRDSEIGLLIEDKEMINSHMGGKPWKAGKFSLSLRLSLWSEHLGIRAGEMNQIIDPVVDSTYKDIWMATAKANTTIYQDVFSCIPNDFIHSRA 1027

ppa000572m 3.43e-8979.38%ppa000572m
HSP 1
Score: 323.939 bits (829), Expect = 3.42544e-89
Identity = 154/194 (79.38%), Postives = 173/194 (89.18%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRS 584
LLPGFQGGVDD GAA VR +MHWQYRTI ++SILHNL VLLGPK HDYISFYGLR+YGRLFEGGPV+TSQVYVHSK+MIIDD ++LIGS+NINDRSLLGSRDSEIGV+IED+EF++S M G PWKAGKFA SLR +LWSEHLGL A EINQI DPV D TYKD+W+ATAK N++IYQDVFSCIPND IHSR+
Sbjct: 818 LLPGFQGGVDDGGAATVRALMHWQYRTISWEKHSILHNLKVLLGPKTHDYISFYGLRSYGRLFEGGPVSTSQVYVHSKVMIIDDCVALIGSSNINDRSLLGSRDSEIGVVIEDKEFLESSMNGLPWKAGKFAYSLRCSLWSEHLGLHAGEINQISDPVSDTTYKDLWLATAKENSIIYQDVFSCIPNDSIHSRA 1011

ppa001528m 1.52e-1232.93%ppa001528m
HSP 1
Score: 69.3218 bits (168), Expect = 1.52071e-12
Identity = 54/164 (32.93%), Postives = 80/164 (48.78%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVL-LGPKLHDYISFY--GLRAYGRLFEGGPVATSQ---------------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGL 440
++P + G+ +S +V+ I+HWQ T+ I+ L L DY++F+ G R R E P + +YVH+K+MI+DD +IGSANIN RS+ G+RD+EI + + + + G LRLALW EHLGL
Sbjct: 566 VMPMWPEGIPES--QSVQAILHWQKMTMEMMYKDIVQALQAKGLEANARDYLTFFCLGNREKKRSGEYEPPEKPEHDTDYSRAQQARRFMIYVHAKVMIVDDEYIIIGSANINQRSMDGARDTEIAMGAYQPYHLSTREAARGQIHG-----LRLALWYEHLGL 722

ppa022510m 7.55e-1232.12%ppa022510m
HSP 1
Score: 67.0106 bits (162), Expect = 7.5472e-12
Identity = 53/165 (32.12%), Postives = 82/165 (49.70%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLH--DYISFYGLRAYGRLFEG------GPVATSQ-----------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGV-LIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLG 437
++P + G+ +S +V+ I+HW T+ Y ++ G + H DY++FY L +G P + +Q VYVHSK+MI+DD +IGSANIN RS+ G RD+EI + + + D M AG + R++LW EH+G
Sbjct: 522 VIPMWPEGLPES--ESVQDILHWTRETMSM-MYRLIGEAIKESGVEGHPRDYLNFYCLANREVESQGDFIPPHSPNSATQYGNAQKHRRFMVYVHSKLMIVDDAYLIIGSANINQRSMDGHRDTEIAIGCYQSKNGDDKAM----MSAGGDIEAYRMSLWYEHIG 679

ppa001818m 9.86e-1233.74%ppa001818m
HSP 1
Score: 66.6254 bits (161), Expect = 9.85695e-12
Identity = 55/163 (33.74%), Postives = 83/163 (50.92%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLH--DYISFY--GLRAYGRLFEGGPVATSQ---------------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHL 434
++P + G+ +S A+V+ I+ WQ RT+ Y+ + G H DY++F+ G R + E P T + +YVHSK+MI+DD ++GSANIN RS+ GSRDSEI + E + + P + +A RL+LW EHL
Sbjct: 521 VVPMWPEGIPES--ASVQAILDWQRRTM-EMMYTDISEALQRRGSNEHPKDYLTFFCLGNRQMEKDGEYKPPETPEPDTDYRRAQQARRFMIYVHSKMMIVDDEYIILGSANINQRSMDGSRDSEIAMGAFQPEHLATT---DPARGQIYA--FRLSLWFEHL 675

ppa001300m 2.87e-1132.03%ppa001300m
HSP 1
Score: 65.0846 bits (157), Expect = 2.86793e-11
Identity = 49/153 (32.03%), Postives = 79/153 (51.63%), Query Frame = 3
Query:   33 DSGAAAVRTIMHWQYRTICRGQYSILHNL--SVLLGPKLH----DYISFYGLRAYGRLFE------GGPVATS------QVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLG 437
D +AA++ I+ WQ +T+ + Y I+ SV L H DY++FY L +L E G V+ + +YVH+K M++DD ++GSANIN RS+ G++D+EI + + + P+ R++LW+EHLG
Sbjct: 628 DPKSAAMQEILFWQSQTM-QAMYDIVAKALKSVQLQDSHHSHPQDYLNFYCLGNREKLSEETSNDNGASVSDAYKYQRFMIYVHAKGMVVDDEYVILGSANINQRSMAGTKDTEIAMGAYQPHYTWAERRKHPFGQ---IYGYRMSLWAEHLG 776

ppa000580m 5.41e-1030.82%ppa000580m
HSP 1
Score: 60.8474 bits (146), Expect = 5.40869e-10
Identity = 49/159 (30.82%), Postives = 76/159 (47.80%), Query Frame = 3
Query:   45 AAVRTIMHWQYRTICRGQYSILHNLSVLLGPK----LHDYISFYGLRAYGRL------FEGGPVATS------------QVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFAS------SLRLALWSEHLG 437
AA + I+ WQ++T+ + Y ++ V +G + DY++F+ L + G P A + +YVHSK MI+DD ++GSANIN RS+ G+RD+EI + S W A K +S R++LW+EH G
Sbjct: 858 AATQRILFWQHKTM-QMMYETIYKALVEVGLEGAFSPQDYLNFFCLGNREAIDGNDTSVSGSPTAANTPQALSQKSRRFMIYVHSKGMIVDDEYVIVGSANINQRSMEGTRDTEIA--------MGSYQPHHTW-ARKHSSPHGQIYGYRMSLWAEHTG 1006

ppa001519m 5.41e-1029.84%ppa001519m
HSP 1
Score: 60.8474 bits (146), Expect = 5.40869e-10
Identity = 57/191 (29.84%), Postives = 90/191 (47.12%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKL--HDYISFY--GLRAYGRLFEGGPVATSQ---------------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGL------------SAAEINQIKDPVVD 482
++P + G+ +S A+V+ I+ WQ RT+ YS + N G + +Y++F+ G R + E P + +YVH+K+MI+DD +IGSANIN RS+ G+RDSEI + + + + G+ R+ALW EHLG+ ++NQI D D
Sbjct: 570 VVPMWPEGIPES--ASVQAILDWQRRTMDM-MYSDIFNSFKERGIEEDPRNYLTFFCLGNREVKKPGEYEPSERPEPDSDYIRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAM----GAYQPYHLSVREPARGQI-HGFRMALWYEHLGMLDEKFLQPESVECVTKVNQIADKYWD 752

ppa001322m 5.98e-0930.19%ppa001322m
HSP 1
Score: 57.3806 bits (137), Expect = 5.98001e-09
Identity = 48/159 (30.19%), Postives = 73/159 (45.91%), Query Frame = 3
Query:   42 AAAVRTIMHWQYRTICRGQYSILHNLSVLLG--PKLH--DYISFYGLRAYGRLFEGGPVATSQ-----------------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGK------FASSLRLALWSEHLG 437
A+AV+ I++WQ +T+ Y ++ G + H D+++FY L T+Q +YVH+K MI+DD ++GSANIN RS+ GSRD+EI + + W A K R++LW+EHLG
Sbjct: 622 ASAVQEILYWQAQTMVM-MYQVISKALEDAGLFDQYHPQDFLNFYCLGQREAPSSRSSSQTNQPTDNRGLALAQKFRRFMIYVHAKGMIVDDEYVIMGSANINQRSMDGSRDTEIA--------MGAYQPHHTWAAEKNLHPHGQVYGYRMSLWAEHLG 771

ppa026639m 1.74e-0839.73%ppa026639m
HSP 1
Score: 55.8398 bits (133), Expect = 1.73992e-08
Identity = 29/73 (39.73%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  219 VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLG 437
+YVHSK MI+DD ++GSANIN RS+ G+RD+EI + + + P R++LW+EH+G
Sbjct: 701 IYVHSKGMIVDDEYVILGSANINQRSMEGTRDTEIAMGAYQPQHTWASKRSSPHGQ---IYGYRMSLWAEHIG 770

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CF811171
Best 10 Hits Shown

Match Name E value Identity Description
PLDP1_ARATH2.50e-8882.38%
Phospholipase D p1 OS=Arabidopsis thalia...
HSP 1
Score: 323.939 bits (829), Expect = 2.5027e-88
Identity = 159/193 (82.38%), Postives = 171/193 (88.60%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSR 581
LLPGFQGG+DDSGAA+VR IMHWQYRTI RG SIL NL +G K HDYISFYGLRAYG+L E GPVATSQVYVHSKIMI+DDR +LIGSANINDRSLLGSRDSEIGVLIED E VDS M GKPWKAGKF+SSLRL+LWSEHLGL EI+QI DPV D+TYK+IWMATAKTNTMIYQDVFSC+PNDLIHSR
Sbjct: 822 LLPGFQGGIDDSGAASVRAIMHWQYRTIYRGHNSILTNLYNTIGVKAHDYISFYGLRAYGKLSEDGPVATSQVYVHSKIMIVDDRAALIGSANINDRSLLGSRDSEIGVLIEDTELVDSRMAGKPWKAGKFSSSLRLSLWSEHLGLRTGEIDQIIDPVSDSTYKEIWMATAKTNTMIYQDVFSCVPNDLIHSR 1014

HSP 2
Score: 23.0978 bits (48), Expect = 2.5027e-88
Identity = 8/12 (66.67%), Postives = 10/12 (83.33%), Query Frame = 1
Query:  586 SLRQSTTYWKEK 621
+ RQS +YWKEK
Sbjct: 1016 AFRQSLSYWKEK 1027

PLDP2_ARATH8.23e-8171.29%
Phospholipase D p2 OS=Arabidopsis thalia...
HSP 1
Score: 299.671 bits (766), Expect = 8.2284e-81
Identity = 144/202 (71.29%), Postives = 168/202 (83.17%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRSLTETIHNL 608
LLPGFQGG+DD GAA VR +MHWQYRTI R SIL NL+ LLGPK DYISFYGLR+YGRLFE GP+ATSQ+YVHSK+MI+DDR+++IGS+NINDRSLLGSRDSEIGV+IED+EFV+S M G W AGKF+ SLR +LWSEHLGL A EI +I+DP+ DATYKD+WMATAK NT IY VFSCIPN+ I SR+ HN+
Sbjct: 777 LLPGFQGGIDDFGAATVRALMHWQYRTISREGTSILDNLNALLGPKTQDYISFYGLRSYGRLFEDGPIATSQIYVHSKLMIVDDRIAVIGSSNINDRSLLGSRDSEIGVVIEDKEFVESSMNGMKWMAGKFSYSLRCSLWSEHLGLHAGEIQKIEDPIKDATYKDLWMATAKKNTDIYNQVFSCIPNEHIRSRAALR--HNM 976

PLD1_RAT2.05e-4749.48%
Phospholipase D1 OS=Rattus norvegicus GN...
HSP 1
Score: 188.734 bits (478), Expect = 2.04561e-47
Identity = 95/192 (49.48%), Postives = 127/192 (66.15%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHS 578
LLPGF+G + G A++ IMH+ YRT+CRG+ SIL L LG K +YISF GLR + L G + T +YVHSK++I DD +IGSANINDRS+LG RDSE+ V+++D E V S M GK ++AG+FA LRL + LG + I+DPV D +K+IW++TA N IY VF C+PND +H+
Sbjct: 823 LLPGFEGDISTGGGNALQAIMHFNYRTMCRGESSILEQLKPELGNKWINYISFCGLRTHAEL--EGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFAQGLRLECFRLVLGYLSDPSEDIQDPVSDKFFKEIWVSTAARNATIYDKVFRCLPNDEVHN 1012

PLD1_MOUSE4.56e-4748.96%
Phospholipase D1 OS=Mus musculus GN=Pld1...
HSP 1
Score: 187.578 bits (475), Expect = 4.55715e-47
Identity = 94/192 (48.96%), Postives = 127/192 (66.15%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHS 578
LLPGF+G + G A++ IMH+ YRT+CRG+ SIL L LG K +YISF GLR + L G + T +YVHSK++I DD +IGSANINDRS+LG RDSE+ V+++D E V S M GK ++AG+FA LRL + LG + ++DPV D +K+IW++TA N IY VF C+PND +H+
Sbjct: 823 LLPGFEGDISTGGGNALQAIMHFNYRTMCRGESSILEQLKPELGNKWINYISFCGLRTHAEL--EGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARDLRLECFRLVLGYLSDPSEDLQDPVSDKFFKEIWVSTAARNATIYDKVFRCLPNDEVHN 1012

PLD2_BOVIN1.33e-4647.50%
Phospholipase D2 OS=Bos taurus GN=PLD2 P...
HSP 1
Score: 186.037 bits (471), Expect = 1.32593e-46
Identity = 95/200 (47.50%), Postives = 134/200 (67.00%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHS-RSLTETI 599
LLPGF+G + G +++ I+H+ YRT+CRG+YSILH L +G + +YIS GLR +G L GG + +Y+HSK++I DDR +IGSANINDRSLLG RDSE+ VLIED E S M G ++AG+FA SLR +S LG +A ++DPV DA ++ +W TA++N IY+ +F C+P++ S R+L E +
Sbjct: 683 LLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHRLKAAMGTEWRNYISVCGLRTHGEL--GGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLLGKRDSELAVLIEDTEMEPSLMNGVEYQAGRFALSLRKHCFSVILGAAARPHLDLRDPVCDAFFQ-LWQDTAESNANIYEQIFRCLPSNATRSLRALREYV 879

PLD1_HUMAN1.73e-4648.44%
Phospholipase D1 OS=Homo sapiens GN=PLD1...
HSP 1
Score: 185.652 bits (470), Expect = 1.73172e-46
Identity = 93/192 (48.44%), Postives = 126/192 (65.62%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHS 578
LLPGF+G + G A++ IMH+ YRT+CRG+ SIL L LG + +YISF GLR + L G + T +YVHSK++I DD +IGSANINDRS+LG RDSE+ V+++D E V S M GK ++AG+FA LRL + LG I+DPV D +K++W++TA N IY VF C+PND +H+
Sbjct: 823 LLPGFEGDISTGGGNALQAIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAEL--EGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARGLRLQCFRVVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHN 1012

PLD1_CRIGR1.91e-4548.17%
Phospholipase D1 OS=Cricetulus griseus G...
HSP 1
Score: 182.185 bits (461), Expect = 1.91464e-45
Identity = 92/191 (48.17%), Postives = 125/191 (65.45%), Query Frame = 3
Query:    6 LPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHS 578
LPGF+G + G A++ IMH+ YRT+CRG+ SIL L LG + +YISF GLR + L G + T +YVHSK++I DD +IGSANINDRS+LG RDSE+ V+++D E V S M GK ++AG FA LRL + LG + ++DPV D +K+IW++TA N IY VF C+PND +H+
Sbjct: 786 LPGFEGDISTGGGNALQAIMHFNYRTMCRGENSILGQLKPELGNQWINYISFCGLRTHAEL--EGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSIMDGKEYQAGCFAQGLRLQCFRLVLGYLSDPSEDLQDPVSDKFFKEIWVSTAARNATIYDKVFRCLPNDEVHN 974

PLD2_HUMAN9.50e-4545.50%
Phospholipase D2 OS=Homo sapiens GN=PLD2...
HSP 1
Score: 179.874 bits (455), Expect = 9.50225e-45
Identity = 91/200 (45.50%), Postives = 129/200 (64.50%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHS-RSLTETI 599
LLPGF+G + G +++ I+H+ YRT+CRG+YSILH L +G DYIS GLR +G L GG + +Y+HSK++I DDR +IGSANINDRSLLG RDSE+ VLIED E S M G ++AG+FA SLR + LG + ++DP+ D ++ +W A++N IY+ +F C+P++ S R+L E +
Sbjct: 683 LLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHRLKAAMGTAWRDYISICGLRTHGEL--GGHPVSELIYIHSKVLIADDRTVIIGSANINDRSLLGKRDSELAVLIEDTETEPSLMNGAEYQAGRFALSLRKHCFGVILGANTRPDLDLRDPICDDFFQ-LWQDMAESNANIYEQIFRCLPSNATRSLRTLREYV 879

PLD2_RAT1.24e-4445.50%
Phospholipase D2 OS=Rattus norvegicus GN...
HSP 1
Score: 179.489 bits (454), Expect = 1.24103e-44
Identity = 91/200 (45.50%), Postives = 130/200 (65.00%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHS-RSLTETI 599
LLPGF+G + G +++ I+H+ YRT+CRG+YSILH L +G DY+S GLR +G L GG + +Y+HSK++I DDR +IGSANINDRSLLG RDSE+ +LI+D E S M G ++AG+FA SLR +S LG + ++DPV D ++ +W TA+ N IY+ +F C+P++ S R+L E +
Sbjct: 683 LLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHRLKAAMGTAWRDYMSICGLRTHGEL--GGHPISELIYIHSKLLIADDRTVIIGSANINDRSLLGKRDSELAILIKDTEMEPSLMDGVEYQAGRFALSLRGRCFSVILGANTWPDLDLRDPVCDDFFQ-LWQETAENNATIYEQIFRCLPSNATRSLRALREYV 879

PLD2_MOUSE4.72e-4445.00%
Phospholipase D2 OS=Mus musculus GN=Pld2...
HSP 1
Score: 177.563 bits (449), Expect = 4.71592e-44
Identity = 90/200 (45.00%), Postives = 130/200 (65.00%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHS-RSLTETI 599
LLPGF+G + G +++ I+H+ YRT+CRG++SILH L +G DY+S GLR +G L GG + +Y+HSK++I DDR +IGSANINDRSLLG RDSE+ +LI+D E S M G ++AG+FA SLR +S LG + ++DPV D ++ +W TA+ N IY+ +F C+P++ S R+L E +
Sbjct: 683 LLPGFEGDISTGGGNSIQAILHFTYRTLCRGEHSILHRLKAAMGTAWRDYMSICGLRTHGEL--GGHPISELIYIHSKMLIADDRTVIIGSANINDRSLLGKRDSELAILIKDTEMEPSLMDGVEYQAGRFALSLRKHCFSVILGANTWPDLDLRDPVCDDFFQ-LWQETAENNATIYEQIFRCLPSNATRSLRALREYV 879

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CF811171
Best 10 Hits Shown

Match Name E value Identity Description
B9N018_POPTR8.65e-9183.51%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 336.65 bits (862), Expect = 8.65482e-91
Identity = 162/194 (83.51%), Postives = 177/194 (91.24%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRS 584
LLPGFQGGVDD GAA+VR IMHWQYRTICRGQ SILHNL LGPK HDYISFYGLR+YGRLF+GGPVATSQVYVHSKIMIIDDR +LIGSANINDRSLLGSRDSEIGVLIED+E VDS MGGKP KAGKF SLRL+LWSEHLGL + IN++ DPV+D+TYKDIWM+TAKTNTMIYQDVFSC+PNDLIH+R+
Sbjct: 823 LLPGFQGGVDDGGAASVRAIMHWQYRTICRGQNSILHNLYDHLGPKTHDYISFYGLRSYGRLFDGGPVATSQVYVHSKIMIIDDRTTLIGSANINDRSLLGSRDSEIGVLIEDKELVDSLMGGKPRKAGKFTLSLRLSLWSEHLGLHSKAINKVIDPVIDSTYKDIWMSTAKTNTMIYQDVFSCVPNDLIHTRA 1016

B9HXE8_POPTR3.56e-9081.96%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 334.339 bits (856), Expect = 3.55782e-90
Identity = 159/194 (81.96%), Postives = 177/194 (91.24%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRS 584
LLPGFQGGVDD GAA+VR IMHWQYRTICRGQ S+LHNL LLGPK DYISFYGLRAYG+L GGPV TSQVYVHSKIMI+DDR +LIGSANINDRSLLGSRDSEIGVLIED+EFVDS MGGKPWKAGKFA SLRL+LWSEHLGL A EI+++ DPV+++TYKD WM+TAKTNTMIYQDVFSC+P+DLIH+R+
Sbjct: 847 LLPGFQGGVDDGGAASVRAIMHWQYRTICRGQNSVLHNLYDLLGPKTQDYISFYGLRAYGQLSNGGPVVTSQVYVHSKIMIVDDRATLIGSANINDRSLLGSRDSEIGVLIEDKEFVDSLMGGKPWKAGKFALSLRLSLWSEHLGLHAKEIHKVIDPVIESTYKDRWMSTAKTNTMIYQDVFSCVPSDLIHTRA 1040

HSP 2
Score: 22.7126 bits (47), Expect = 3.55782e-90
Identity = 7/12 (58.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  586 SLRQSTTYWKEK 621
+LRQST +WK++
Sbjct: 1041 ALRQSTAFWKDR 1052

B9RTA5_RICCO2.13e-8981.96%
Phospholipase d zeta, putative OS=Ricinu...
HSP 1
Score: 332.028 bits (850), Expect = 2.13176e-89
Identity = 159/194 (81.96%), Postives = 177/194 (91.24%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRS 584
L+PGFQGG+DDSGAA+VR IMHWQYRTICRGQ SI HNL +LGPK HDYISFYGLRAYG+LF+GGPVATSQVYVHSKIMIIDD +LIGSANINDRSLLGSRDSEI VLIED+E VDS MGG+ WKAGKF+ SLRL+LWSEHLGL+A E+ QI DPV+D+TYKDIW+ATAKTNT IYQDVFSCIPNDL+HSR+
Sbjct: 844 LIPGFQGGLDDSGAASVRAIMHWQYRTICRGQNSIFHNLYDVLGPKTHDYISFYGLRAYGKLFDGGPVATSQVYVHSKIMIIDDCATLIGSANINDRSLLGSRDSEIAVLIEDKEMVDSFMGGRHWKAGKFSLSLRLSLWSEHLGLNAKEMKQIIDPVIDSTYKDIWIATAKTNTTIYQDVFSCIPNDLMHSRA 1037

D7SYA0_VITVI2.36e-8881.96%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 328.561 bits (841), Expect = 2.35693e-88
Identity = 159/194 (81.96%), Postives = 175/194 (90.21%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRS 584
LLPGFQGG+DD GAA+VR IMHWQYRTICRG SIL NL ++G K HDYISFYGLRAYGRLF+GGPVA+SQVYVHSKIMI+DD +LIGSANINDRSLLGSRDSEIGVLIED+E VDS MGGKP KAGKFA SLRL+LWSEHLGL EI+QIKDPVVD+TY+D+WMATAKTN+ IYQDVFSCIPNDLIHSR+
Sbjct: 847 LLPGFQGGLDDGGAASVRAIMHWQYRTICRGNNSILQNLYDVIGHKTHDYISFYGLRAYGRLFDGGPVASSQVYVHSKIMIVDDCTTLIGSANINDRSLLGSRDSEIGVLIEDKELVDSYMGGKPKKAGKFAHSLRLSLWSEHLGLRGGEIDQIKDPVVDSTYRDVWMATAKTNSTIYQDVFSCIPNDLIHSRA 1040

D7L671_ARALY4.26e-8883.42%
Putative uncharacterized protein OS=Arab...
HSP 1
Score: 327.02 bits (837), Expect = 4.2578e-88
Identity = 161/193 (83.42%), Postives = 172/193 (89.12%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSR 581
LLPGFQGG+DDSGAA+VR IMHWQYRTI RG SIL NL +G K HDYISFYGLRAYG+L E GPVATSQVYVHSKIMIIDDR +LIGSANINDRSLLGSRDSEIGVLIED EFVDS M GKPWKAGKF+SSLRL+LWSEHLGL EI+QI DPV D+TYK+IWMATAKTNTMIYQDVFSC+PNDLIHSR
Sbjct: 823 LLPGFQGGIDDSGAASVRAIMHWQYRTIYRGHNSILTNLYNTIGAKAHDYISFYGLRAYGKLSEDGPVATSQVYVHSKIMIIDDRAALIGSANINDRSLLGSRDSEIGVLIEDTEFVDSRMAGKPWKAGKFSSSLRLSLWSEHLGLRTGEIDQIIDPVSDSTYKEIWMATAKTNTMIYQDVFSCVPNDLIHSR 1015

HSP 2
Score: 23.0978 bits (48), Expect = 4.2578e-88
Identity = 8/12 (66.67%), Postives = 10/12 (83.33%), Query Frame = 1
Query:  586 SLRQSTTYWKEK 621
+ RQS +YWKEK
Sbjct: 1017 AFRQSLSYWKEK 1028

Q6L479_ORYSJ2.06e-8475.77%
Putative phospholipase D OS=Oryza sativa...
HSP 1
Score: 315.464 bits (807), Expect = 2.06477e-84
Identity = 147/194 (75.77%), Postives = 172/194 (88.66%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRS 584
LLPGFQGG+DD GAA+VR IMHWQYRTICRG SIL NL ++GPK HDYISFYGLRA+GRL EGGP+ T+Q+YVHSK+MIIDDR++LIGSANINDRSLLGSRDSEI V+IED+E V S M GKPW+AGKF+ SLRL+LW+EHLGL E++ I DP+ D+T+K+IWMATAKTNTMIYQDVFSC+PNDLIHSR+
Sbjct: 810 LLPGFQGGIDDGGAASVRAIMHWQYRTICRGPNSILQNLYDVIGPKAHDYISFYGLRAHGRLCEGGPLVTNQIYVHSKLMIIDDRITLIGSANINDRSLLGSRDSEIAVVIEDKEVVSSKMNGKPWEAGKFSLSLRLSLWAEHLGLHRGEVSHIMDPIDDSTFKNIWMATAKTNTMIYQDVFSCVPNDLIHSRA 1003

B9FP50_ORYSJ2.06e-8475.77%
Putative uncharacterized protein OS=Oryz...
HSP 1
Score: 315.464 bits (807), Expect = 2.06477e-84
Identity = 147/194 (75.77%), Postives = 172/194 (88.66%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRS 584
LLPGFQGG+DD GAA+VR IMHWQYRTICRG SIL NL ++GPK HDYISFYGLRA+GRL EGGP+ T+Q+YVHSK+MIIDDR++LIGSANINDRSLLGSRDSEI V+IED+E V S M GKPW+AGKF+ SLRL+LW+EHLGL E++ I DP+ D+T+K+IWMATAKTNTMIYQDVFSC+PNDLIHSR+
Sbjct: 884 LLPGFQGGIDDGGAASVRAIMHWQYRTICRGPNSILQNLYDVIGPKAHDYISFYGLRAHGRLCEGGPLVTNQIYVHSKLMIIDDRITLIGSANINDRSLLGSRDSEIAVVIEDKEVVSSKMNGKPWEAGKFSLSLRLSLWAEHLGLHRGEVSHIMDPIDDSTFKNIWMATAKTNTMIYQDVFSCVPNDLIHSRA 1077

B8AX48_ORYSI2.70e-8476.17%
Putative uncharacterized protein OS=Oryz...
HSP 1
Score: 315.079 bits (806), Expect = 2.69668e-84
Identity = 147/193 (76.17%), Postives = 171/193 (88.60%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSR 581
LLPGFQGG+DD GAA+VR IMHWQYRTICRG SIL NL ++GPK HDYISFYGLRA+GRL EGGP+ T+Q+YVHSK+MIIDDR++LIGSANINDRSLLGSRDSEI V+IED+E V S M GKPW+AGKF+ SLRL+LW+EHLGL E++ I DP+ D+T+K+IWMATAKTNTMIYQDVFSC+PNDLIHSR
Sbjct: 862 LLPGFQGGIDDGGAASVRAIMHWQYRTICRGPNSILQNLYDVIGPKAHDYISFYGLRAHGRLCEGGPLVTNQIYVHSKLMIIDDRITLIGSANINDRSLLGSRDSEIAVVIEDKEVVSSKMNGKPWEAGKFSLSLRLSLWAEHLGLHRGEVSHIMDPIDDSTFKNIWMATAKTNTMIYQDVFSCVPNDLIHSR 1054

B9RFF1_RICCO3.00e-8373.71%
Phospholipase d zeta, putative OS=Ricinu...
HSP 1
Score: 307.375 bits (786), Expect = 2.99912e-83
Identity = 143/194 (73.71%), Postives = 170/194 (87.63%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRS 584
LLPGFQGG+DD GAA VR IMHWQYRTI R + SIL NL+ LLGP+ +YISFYGLR YGRLF+GGPVATSQVYVHSK+MI+DD ++++GS+NINDRSLLGSRDSEIGV+IED+EFVDS M G+PWKAGKF SLR +LWSEHLGLSA EIN+I DPV + TY+D+W+A AK NT IYQDVF+C+P++LIHSR+
Sbjct: 803 LLPGFQGGLDDGGAATVRAIMHWQYRTISREKTSILDNLNTLLGPQTQNYISFYGLRTYGRLFKGGPVATSQVYVHSKVMIVDDCVAVVGSSNINDRSLLGSRDSEIGVVIEDKEFVDSSMNGEPWKAGKFTYSLRCSLWSEHLGLSAGEINKISDPVAETTYRDLWLAIAKENTKIYQDVFACLPSELIHSRA 996

HSP 2
Score: 26.5646 bits (57), Expect = 2.99912e-83
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  586 SLRQSTTYWKEK 621
+LRQST YWKEK
Sbjct: 997 ALRQSTNYWKEK 1008

B9I7A7_POPTR1.76e-8072.68%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 302.368 bits (773), Expect = 1.76414e-80
Identity = 141/194 (72.68%), Postives = 167/194 (86.08%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRS 584
L PGFQGGVDD GAA VR IMHWQYRTI R + SIL+NL+ LLGPK HDYISF GLR YGRLF GGP+ TSQVYVHSK+MI+DDR++ IGS+NINDRSLLGSRDSEIG++ ED+EFV+S M G+ WKAGKFA SLR +LWSEHLGLS+ EI++I DPV + TY+D+W+ATAK N+ IYQDVF+C+PND IHSR+
Sbjct: 836 LSPGFQGGVDDGGAATVRAIMHWQYRTISRKKTSILYNLNTLLGPKTHDYISFCGLRTYGRLFVGGPLVTSQVYVHSKVMIVDDRIAYIGSSNINDRSLLGSRDSEIGIVTEDKEFVESSMNGETWKAGKFAYSLRRSLWSEHLGLSSGEIDKISDPVAETTYRDLWLATAKENSKIYQDVFACLPNDHIHSRA 1029

HSP 2
Score: 22.3274 bits (46), Expect = 1.76414e-80
Identity = 8/12 (66.67%), Postives = 10/12 (83.33%), Query Frame = 1
Query:  586 SLRQSTTYWKEK 621
+LRQS +WKEK
Sbjct: 1030 ALRQSMNHWKEK 1041

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CF811171
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010350950011.19e-9081.96%GSVIVT01035095001 assembled CDS
HSP 1
Score: 328.561 bits (841), Expect = 1.18944e-90
Identity = 159/194 (81.96%), Postives = 175/194 (90.21%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRS 584
LLPGFQGG+DD GAA+VR IMHWQYRTICRG SIL NL ++G K HDYISFYGLRAYGRLF+GGPVA+SQVYVHSKIMI+DD +LIGSANINDRSLLGSRDSEIGVLIED+E VDS MGGKP KAGKFA SLRL+LWSEHLGL EI+QIKDPVVD+TY+D+WMATAKTN+ IYQDVFSCIPNDLIHSR+
Sbjct: 847 LLPGFQGGLDDGGAASVRAIMHWQYRTICRGNNSILQNLYDVIGHKTHDYISFYGLRAYGRLFDGGPVASSQVYVHSKIMIVDDCTTLIGSANINDRSLLGSRDSEIGVLIEDKELVDSYMGGKPKKAGKFAHSLRLSLWSEHLGLRGGEIDQIKDPVVDSTYRDVWMATAKTNSTIYQDVFSCIPNDLIHSRA 1040

GSVIVT010358530018.43e-1232.93%GSVIVT01035853001 assembled CDS
HSP 1
Score: 66.6254 bits (161), Expect = 8.43041e-12
Identity = 54/164 (32.93%), Postives = 81/164 (49.39%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVL-LGPKLHDYISFYGL-----------RAYGRLFEGGPVATSQ------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGV-LIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLG 437
++P + G+ +S A+V+ I+ WQ RT+ I+ L + DY++F+ L + + EG +Q +YVHSK+MI+DD +IGSANIN RS+ G RD+EI + + + GG+ G RLALW EHLG
Sbjct: 511 VIPLWPEGIPES--ASVQAILDWQRRTMEMMYTDIVQALQARGIHANPRDYLTFFCLGNRELINADEYKPKEKPAEGSDYMRAQQSRRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGGRDTEIAMGGYQPHHLAATEEGGRGAIHG-----FRLALWYEHLG 667

GSVIVT010233500012.45e-1133.13%GSVIVT01023350001 assembled CDS
HSP 1
Score: 65.0846 bits (157), Expect = 2.45287e-11
Identity = 55/166 (33.13%), Postives = 77/166 (46.39%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSIL----HNLSVLLGPKLHDYISFY--GLRAYGRLFEGGPVATSQ---------------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLG 437
++P + GV S A+V+ I+ WQ +T+ Y I+ H + DY++FY G R + S +YVH+K MI+DD LIGSANIN RSL GSRD+EI + + S GK R++LW+EHLG
Sbjct: 600 VVPMWPEGVPTS--ASVQEILFWQGQTMSM-MYQIIGQAIHKAGLSDTHHPQDYLNFYCLGKREASSTESSAQTSNSSENRALGLAQKFRRFMIYVHAKGMIVDDEYVLIGSANINQRSLDGSRDTEIAMGAYQPSYTWS---GKKTHPHGQVYGYRMSLWAEHLG 759

GSVIVT010087340014.63e-1032.30%GSVIVT01008734001 assembled CDS
HSP 1
Score: 60.8474 bits (146), Expect = 4.62592e-10
Identity = 52/161 (32.30%), Postives = 79/161 (49.07%), Query Frame = 3
Query:   45 AAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLH--DYISFYGLR---------AYGRLFEGGPVATSQ------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGV-LIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDP 473
A+V+ I+ WQ +T+ I L + H DY++FY L + V+TS+ +YVH+K MI+DD ++GSANIN RS+ GSRD+EI + + R + K G+ R++LW+EHLG+ N K+P
Sbjct: 596 ASVQEILFWQGQTMQMMYDIIAQELQSMQLEDAHPQDYLNFYCLGNREEPPKEVSSSNTQASDGVSTSKKFHRFMIYVHAKGMIVDDEYVILGSANINQRSMAGSRDTEIAMGAYQPRH---TWAKKKKHPHGQI-YGYRMSLWAEHLGMIN---NSFKEP 749

GSVIVT010155430011.03e-0945.68%GSVIVT01015543001 assembled CDS
HSP 1
Score: 59.6918 bits (143), Expect = 1.03055e-09
Identity = 37/81 (45.68%), Postives = 47/81 (58.02%), Query Frame = 3
Query:  219 VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGG-KPW------KAGKFASSLRLALWSEHLGL 440
+YVH+K+MI+DD +IGSANIN RS+ G+RDSEI MGG +P+ A R+ALW EHLGL
Sbjct: 452 IYVHAKMMIVDDEYIVIGSANINQRSMDGARDSEI------------AMGGYQPYHLATKQPARGQIHGFRMALWYEHLGL 520

GSVIVT010168760011.76e-0944.74%GSVIVT01016876001 assembled CDS
HSP 1
Score: 58.9214 bits (141), Expect = 1.75785e-09
Identity = 34/76 (44.74%), Postives = 45/76 (59.21%), Query Frame = 3
Query:  219 VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDS--CMGGKPWKAGKFASSLRLALWSEHLGL 440
VYVHSK+MI+DD LIGSAN+N RS+ G RD+EI V + ++ C G + R++LW EH GL
Sbjct: 799 VYVHSKLMIVDDTYILIGSANVNQRSMDGQRDTEIAVGCYQSKNGENEMCRGD--------IHAYRMSLWYEHTGL 866

GSVIVT010155420012.30e-0944.59%GSVIVT01015542001 assembled CDS
HSP 1
Score: 58.5362 bits (140), Expect = 2.29582e-09
Identity = 33/74 (44.59%), Postives = 44/74 (59.46%), Query Frame = 3
Query:  219 VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGL 440
+YVH+K+MI+DD + GSANIN RS+ G+RDSEI + + + K G R+ALW EHLGL
Sbjct: 551 IYVHAKMMIVDDEYIITGSANINQRSMDGARDSEIAM----GAYQPYHLASKQPARGHI-HGFRMALWYEHLGL 619

GSVIVT010173170013.00e-0943.21%GSVIVT01017317001 assembled CDS
HSP 1
Score: 58.151 bits (139), Expect = 2.99843e-09
Identity = 35/81 (43.21%), Postives = 47/81 (58.02%), Query Frame = 3
Query:  219 VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGG-KPW------KAGKFASSLRLALWSEHLGL 440
+YVH+K+MI+DD +IGSANIN RS+ G+RDSEI MGG +P+ A R++LW EHLG+
Sbjct: 2 IYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEI------------AMGGYQPYHLASRQPARGQIHGFRMSLWYEHLGM 70

GSVIVT010275870015.11e-0930.52%GSVIVT01027587001 assembled CDS
HSP 1
Score: 57.3806 bits (137), Expect = 5.11455e-09
Identity = 47/154 (30.52%), Postives = 75/154 (48.70%), Query Frame = 3
Query:   45 AAVRTIMHWQYRTICRGQYSILHNLSVLLGPKL----HDYISFYGLRAYGRLFEGG--PVATS-----------------QVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLG 437
AA + I+ WQ++T+ + Y ++ V +G + DY++F+ L +G P TS +YVHSK MI+DD ++GSANIN RS+ G+RD+EI + + + P G+ R++LW+EH G
Sbjct: 709 AATQRILFWQHKTM-QMMYETIYKALVEVGLEEAFTPQDYLNFFCL-GNREAVDGSETPGTTSPTAANTPQAHSRKNRRFMIYVHSKGMIVDDEYVILGSANINQRSMEGTRDTEIAMGAYQPHYTWARKLSNP--RGQI-YGYRMSLWAEHTG 857

GSVIVT010198790011.14e-0829.52%GSVIVT01019879001 assembled CDS
HSP 1
Score: 56.225 bits (134), Expect = 1.1394e-08
Identity = 49/166 (29.52%), Postives = 80/166 (48.19%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNL--SVLLGPKLH--DYISFYGL----------RAYGRLFEGGPVATSQ------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGL 440
++P + GV S + I+ WQ++T+ + Y +++ V L + H DY++F+ L A + P A ++ +YVHSK MI+DD +IGSANIN RS+ G+RD+EI + + P R++LW+EH G+
Sbjct: 598 VIPMWPEGVPTS--TPTQRILFWQHKTM-QMMYEMVYKALQEVGLENQYHPQDYLNFFCLGNREEGVDTSNAGNQSAANTPQALARKSRRFMIYVHSKGMIVDDEYLIIGSANINQRSMEGTRDTEIAMGAYQPHHTWARKQSSPHGQ---IYGYRMSLWAEHTGV 757

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CF811171
Best 10 Hits Shown

Match Name E value Identity Description
AT3G16785.1 2.59e-8982.38%
phospholipase D P1 | chr3:5711329-57186...
HSP 1
Score: 323.939 bits (829), Expect = 2.58528e-89
Identity = 159/193 (82.38%), Postives = 171/193 (88.60%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSR 581
LLPGFQGG+DDSGAA+VR IMHWQYRTI RG SIL NL +G K HDYISFYGLRAYG+L E GPVATSQVYVHSKIMI+DDR +LIGSANINDRSLLGSRDSEIGVLIED E VDS M GKPWKAGKF+SSLRL+LWSEHLGL EI+QI DPV D+TYK+IWMATAKTNTMIYQDVFSC+PNDLIHSR
Sbjct: 822 LLPGFQGGIDDSGAASVRAIMHWQYRTIYRGHNSILTNLYNTIGVKAHDYISFYGLRAYGKLSEDGPVATSQVYVHSKIMIVDDRAALIGSANINDRSLLGSRDSEIGVLIEDTELVDSRMAGKPWKAGKFSSSLRLSLWSEHLGLRTGEIDQIIDPVSDSTYKEIWMATAKTNTMIYQDVFSCVPNDLIHSR 1014

HSP 2
Score: 23.0978 bits (48), Expect = 2.58528e-89
Identity = 8/12 (66.67%), Postives = 10/12 (83.33%), Query Frame = 1
Query:  586 SLRQSTTYWKEK 621
+ RQS +YWKEK
Sbjct: 1016 AFRQSLSYWKEK 1027

AT3G05630.1 8.51e-8271.29%
phospholipase D P2 | chr3:1635321-16401...
HSP 1
Score: 299.671 bits (766), Expect = 8.50649e-82
Identity = 144/202 (71.29%), Postives = 168/202 (83.17%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLHDYISFYGLRAYGRLFEGGPVATSQVYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDPVVDATYKDIWMATAKTNTMIYQDVFSCIPNDLIHSRSLTETIHNL 608
LLPGFQGG+DD GAA VR +MHWQYRTI R SIL NL+ LLGPK DYISFYGLR+YGRLFE GP+ATSQ+YVHSK+MI+DDR+++IGS+NINDRSLLGSRDSEIGV+IED+EFV+S M G W AGKF+ SLR +LWSEHLGL A EI +I+DP+ DATYKD+WMATAK NT IY VFSCIPN+ I SR+ HN+
Sbjct: 777 LLPGFQGGIDDFGAATVRALMHWQYRTISREGTSILDNLNALLGPKTQDYISFYGLRSYGRLFEDGPIATSQIYVHSKLMIVDDRIAVIGSSNINDRSLLGSRDSEIGVVIEDKEFVESSMNGMKWMAGKFSYSLRCSLWSEHLGLHAGEIQKIEDPIKDATYKDLWMATAKKNTDIYNQVFSCIPNEHIRSRAALR--HNM 976

AT5G25370.1 1.87e-1233.33%
phospholipase D alpha 3 | chr5:8804240-...
HSP 1
Score: 69.3218 bits (168), Expect = 1.86988e-12
Identity = 60/180 (33.33%), Postives = 90/180 (50.00%), Query Frame = 3
Query:   39 GAAAVRTIMHWQYRTICRGQYSILHNLSVL-LGPKLHDYISFY--GLRAYGRLFE----GGPVATSQ-----------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKDP-------VVDATYKDIW 503
G+A+V+ I+ WQ RT+ I+ L L DY++F+ G R G++ E P A S +YVHSK+MI+DD +IGSANIN RS+ G RD+EI + + S +P G+ S R++LW EHL ++ N + P +V+AT ++W
Sbjct: 586 GSASVQAILDWQRRTMEMMYTDIIIALRKKGLDANPRDYLTFFCLGNREKGKVGEYLPPEKPEANSDYARAQESRRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGGRDTEIAMGAYQPSHLLSTNNMRP--VGQI-FSFRISLWLEHLRVTT---NAFQCPESEECIRMVNATADELW 759

AT4G35790.1 1.58e-1130.63%
phospholipase D delta | chr4:16955774-1...
HSP 1
Score: 66.2402 bits (160), Expect = 1.58295e-11
Identity = 49/160 (30.63%), Postives = 78/160 (48.75%), Query Frame = 3
Query:   33 DSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLH--DYISFYGLRAYGRLFEGGPVATSQV------------YVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKD 470
D + V+ I++WQ +T+ + Y ++ + H DY++FY L +L + P V YVH+K MI+DD L+GSANIN RS+ G++D+EI + + G P G+ R++LW+EHLG + E + D
Sbjct: 640 DPKSGPVQEILYWQSQTM-QMMYDVIAKELKAVQSDAHPLDYLNFYCLGKREQLPDDMPATNGSVVSDSYNFQRFMIYVHAKGMIVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPNHTWAHKGRHP--RGQ-VYGYRMSLWAEHLGKTGDEFVEPSD 795

AT4G35790.2 1.58e-1130.63%
phospholipase D delta | chr4:16955774-1...
HSP 1
Score: 66.2402 bits (160), Expect = 1.58295e-11
Identity = 49/160 (30.63%), Postives = 78/160 (48.75%), Query Frame = 3
Query:   33 DSGAAAVRTIMHWQYRTICRGQYSILHNLSVLLGPKLH--DYISFYGLRAYGRLFEGGPVATSQV------------YVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQIKD 470
D + V+ I++WQ +T+ + Y ++ + H DY++FY L +L + P V YVH+K MI+DD L+GSANIN RS+ G++D+EI + + G P G+ R++LW+EHLG + E + D
Sbjct: 629 DPKSGPVQEILYWQSQTM-QMMYDVIAKELKAVQSDAHPLDYLNFYCLGKREQLPDDMPATNGSVVSDSYNFQRFMIYVHAKGMIVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPNHTWAHKGRHP--RGQ-VYGYRMSLWAEHLGKTGDEFVEPSD 784

AT1G52570.1 3.53e-1131.98%
phospholipase D alpha 2 | chr1:19583940...
HSP 1
Score: 65.0846 bits (157), Expect = 3.52644e-11
Identity = 55/172 (31.98%), Postives = 84/172 (48.84%), Query Frame = 3
Query:    3 LLPGFQGGVDDSGAAAVRTIMHWQYRTICRGQYSILHNL--SVLLGPKLHDYISFY--GLRAYGRLFEGGPVATSQ---------------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGG-KPW------KAGKFASSLRLALWSEHLGL 440
++P + G+ +SG+ V+ I+ WQ RT+ ++ L + L G DY++F+ G R + E P + +YVH+K+MI+DD +IGSANIN RS+ G+RDSEI MGG +P+ A R++LW EHLG+
Sbjct: 569 VVPMWPEGIPESGS--VQAILDWQKRTMEMMYKDVIKALRENGLEGEDPRDYLTFFCLGNREVKKDGEYEPSEKPEPDTDYIRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEI------------AMGGYQPYHLSTRQPARGQIHGFRMSLWYEHLGM 726

AT1G55180.1 7.86e-1133.78%
phospholipase D alpha 4 | chr1:20585057...
HSP 1
Score: 63.929 bits (154), Expect = 7.85608e-11
Identity = 50/148 (33.78%), Postives = 66/148 (44.59%), Query Frame = 3
Query:   51 VRTIMHWQYRTICRGQYSILHNLSVLLGPKLH--DYISFYGLRAYGRLFEGGPVATSQ-----------------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLG 437
V I+HW T+ Y I+ +G K H DY++F+ L +G A S VYVHSK+MI+DD LIGSANIN RS+ G RD+EI + C + + RL+LW EH G
Sbjct: 538 VEEILHWTRETMSM-MYQIIGEAIWEVGDKSHPRDYLNFFCLANREEKRDGEFEAVSSPHQKTHYWNAQRNRRFMVYVHSKLMIVDDTYILIGSANINQRSMDGCRDTEIAI---------GCYQTNTNNTNEI-QAYRLSLWYEHTG 674

AT4G11840.1 3.90e-1030.12%
phospholipase D gamma 3 | chr4:7122152-...
HSP 1
Score: 61.6178 bits (148), Expect = 3.89893e-10
Identity = 50/166 (30.12%), Postives = 80/166 (48.19%), Query Frame = 3
Query:   51 VRTIMHWQYRTICRGQYSILHNLSVLLGP----KLHDYISFY--GLRAYG-RLFEGGPVATSQ----------------------VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQ 461
++ I++WQ++T+ + Y ++ V +G + D+++F+ G R G R G V+ +YVHSK M++DD LIGSANIN RSL G+RD+EI + + G +P G+ R++LW+EHLG E +
Sbjct: 630 IQRILYWQHKTM-QMMYQTIYKALVEVGLDGQLEPQDFLNFFCLGTREVGTREVPDGTVSVYNSPRKPPQLNAAQVQALKSRRFMIYVHSKGMVVDDEFVLIGSANINQRSLEGTRDTEIAMGGYQPHHSWAKKGSRP--RGQI-FGYRMSLWAEHLGFLEQEFEE 791

AT4G11850.1 3.90e-1045.21%
phospholipase D gamma 1 | chr4:7129352-...
HSP 1
Score: 61.6178 bits (148), Expect = 3.89893e-10
Identity = 33/73 (45.21%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  219 VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLG 437
+YVHSK M++DD LIGSANIN RSL G+RD+EI + + + G +P R++LW+EHLG
Sbjct: 706 IYVHSKGMVVDDEFVLIGSANINQRSLEGTRDTEIAMGGYQPHYSWAMKGSRPHGQ---IFGYRMSLWAEHLG 775

AT4G11830.2 6.65e-1043.21%
phospholipase D gamma 2 | chr4:7115985-...
HSP 1
Score: 60.8474 bits (146), Expect = 6.65057e-10
Identity = 35/81 (43.21%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  219 VYVHSKIMIIDDRLSLIGSANINDRSLLGSRDSEIGVLIEDREFVDSCMGGKPWKAGKFASSLRLALWSEHLGLSAAEINQ 461
+YVHSK M++DD LIGSANIN RSL G+RD+EI + + G +P G+ R++LW+EHLG E +
Sbjct: 704 IYVHSKGMVVDDEFVLIGSANINQRSLEGTRDTEIAMGGYQPHHSWAKKGSRP--RGQI-FGYRMSLWAEHLGFLEQEFEE 781

Related info for CF811171