CF810752

Information for CF810752

NameCF810752
AccessionID20
Length620 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014530 cDNA cold acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CF810752
Sequence
TTGCACCATTGTTCAAGGTATGGTTCTAAAGACTGATGCTGTTGGATCTATAAAGCGAGT
GGAGAAGGCTAAGGTTGCTGTGTTTGCTGGCGGTGTTGATACATCTGCCACTGAAACAAA
AGGAACAGTACTTATTCATAGTGCTGAGCAGCTAGAAAACTATTCAAAAACAGAAGAAGC
AAAAGTTGAAGAGCTTATCAAAGCAGTTGCTGAGTCAGGAGCCAAGGTTATTGTTAGTGG
AGGATCAGTTGGAGAGATGGCACTACACTTTTGTGAACGTTACAAGCTGATGGTCTTAAA
AATAAGCTCCAAGTTTGAATTGCGACGTTTTTGCCGTACAACTGGTGCTGTTGCTCTTTT
GAAGCTTGGTCGGCCAAGCCCCGATGATTTGGGGCACGTTGATTCTGTGTCCGTGGAGGA
AATTGGCGGCGTTAGGGTGACTGTTGTGAGAAATGAAGAAGGTGGAAACTCTGTATCAAC
AGTGGTTCTACGAGGAAGTACTGATAGTATTTTGGATGATCTTGAAAGAGCAGTTGATGA
TGGTGTGAATACATACAAGGCAATGTGTAGGGACAGCCGTATAGTGCCTGGAGCTGCAGC
CACAGAAATTGAGTTACTAA
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0044267 biological_process cellular protein metabolic process
GO:0006457 biological_process protein folding
GO:0005524 molecular_function ATP binding
GO:0005515 molecular_function protein binding
GO:0051082 molecular_function unfolded protein binding

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CF810752_2_ORF1 CRC64: 27C09136B13F85F7 LENGTH: 206 aa
InterPro
IPR002423
Family
Chaperonin Cpn60/TCP-1
PTHR11353 [2-205]T 3.5e-117 PTHR11353 CHAPERONIN CHAPERONIN
PF00118 [2-205]T 1.3e-49 PF00118 Cpn60_TCP1 Cpn60_TCP1
InterPro
IPR012721
Family
T-complex protein 1, theta subunit
PTHR11353:SF19 [2-205]T 3.5e-117 PTHR11353:SF19 CHAPERONIN CONTAINING T-COMPLEX PROTEIN 1, THETA SUBUNIT, TCPQ CHAPERONIN CONTAINING T-COMPLEX PROTEIN 1, THETA SUBUNIT, TCPQ
noIPR
unintegrated
unintegrated
G3DSA:3.30.260.10 [164-191]T 1.4e-07 G3DSA:3.30.260.10 no description no description
G3DSA:3.50.7.10 [1-163]T 1.2e-40 G3DSA:3.50.7.10 no description no description
SSF52029 [4-153]T 3.9e-40 SSF52029 GroEL apical domain-like GroEL apical domain-like
SSF54849 [156-192]T 2.1e-07 SSF54849 GroEL-intermediate domain like GroEL-intermediate domain like

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CF810752
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0013s055005.91e-10090.69%POPTR_0013s05500.1
HSP 1
Score: 360.147 bits (923), Expect = 5.9126e-100
Identity = 185/204 (90.69%), Postives = 195/204 (95.59%), Query Frame = 2
Query:    5 TIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
+IV+GMVLK D VG+IKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENY+KTEEAKVEELIKAVAE+GAKVIVSG +VGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVA+LKL PSPDDLG VDS+SVEEIGG RVT+VRNEEGGNSV TVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRI+PG AATEIEL
Sbjct: 218 SIVRGMVLKGDTVGTIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYAKTEEAKVEELIKAVAETGAKVIVSGAAVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVAILKLSPPSPDDLGCVDSISVEEIGGARVTIVRNEEGGNSVCTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIIPGGAATEIEL 421

POPTR_0019s049806.54e-9990.59%POPTR_0019s04980.1
HSP 1
Score: 356.681 bits (914), Expect = 6.53714e-99
Identity = 183/202 (90.59%), Postives = 192/202 (95.05%), Query Frame = 2
Query:   11 VQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
V+GMVLK D VG++KRVEKAKVAVF GGVDTSATETKGTVLIHSAEQLENY+KTEEAKVEELIKAVA SGAKVIVSG +VGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVA+LKL P+PDDLG+VDS+SVEEIGG RVTVVRNEEGGNSV TVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPG AATEIEL
Sbjct: 220 VRGMVLKGDTVGTLKRVEKAKVAVFVGGVDTSATETKGTVLIHSAEQLENYAKTEEAKVEELIKAVANSGAKVIVSGAAVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVAILKLSPPNPDDLGYVDSISVEEIGGTRVTVVRNEEGGNSVCTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGGAATEIEL 421

POPTR_0015s041502.38e-1623.22%POPTR_0015s04150.1
HSP 1
Score: 82.4185 bits (202), Expect = 2.37961e-16
Identity = 49/211 (23.22%), Postives = 103/211 (48.82%), Query Frame = 2
Query:    8 IVQGMVLK---TDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGS-----VGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
+V+G+V + A G + RVE AK+AV + T+ + ++++ Q++ K E + +IK + +G V++ S V +++LH+ + K++V+K + E+ +T + + + + LG+ D V +G ++ + + + V++RGS +LD+ ER++ D + + + ++ G A EIEL
Sbjct: 216 MVRGLVFDKKVSHAAGGLTRVENAKIAVIQFQISPPKTDIEQSIVVSDYAQMDRILKEERNYILGMIKKIRATGCNVLLIQKSILRDAVTDLSLHYLAKAKILVIKDVERDEIEFITKTLNCLPIANIEHFKEEKLGYADLVEEVSLGDGKIVKITGIKDMGRTTCVLVRGSNQLVLDEAERSLHDALCVIRCLVNKQFLIAGGGAPEIEL 426

POPTR_0012s048601.54e-1523.22%POPTR_0012s04860.1
HSP 1
Score: 79.7221 bits (195), Expect = 1.54242e-15
Identity = 49/211 (23.22%), Postives = 103/211 (48.82%), Query Frame = 2
Query:    8 IVQGMVLK---TDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGS-----VGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
+V+G+V + A G RVE AK+AV + T+ + ++++ Q++ K E + +IK + +G V++ S V +++LH+ + K++V+K + E+ +T + + + + LG+ + V +G ++ + + +TV++RGS +LD+ ER++ D + + + ++ G A EIEL
Sbjct: 214 MVRGLVFDKKVSHAAGGPTRVENAKIAVIQFQISPPKTDIEQSIVVSDYAQMDRILKEERNYILGMIKKIKATGCNVLLIQKSILRDAVTDLSLHYLAKAKILVIKDVERDEIEFITKTLNCLPIANIEHFKEEKLGYANLVEEVSLGDGKIVKITGIKDMGRTTTVLVRGSNHLVLDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIEL 424

POPTR_0014s057504.96e-1425.12%POPTR_0014s05750.1
HSP 1
Score: 74.7146 bits (182), Expect = 4.96179e-14
Identity = 53/211 (25.12%), Postives = 100/211 (47.39%), Query Frame = 2
Query:    8 IVQGMVLKTD--AVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRP------SPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
++ G L T A G + +V A+VA + + + VL+ +L+ + E +E I+ + ++GA V+++ + +MAL + + ++ K ++R + TGA + P LG+ D V E I V +++ + ++VS +VLRG+ D +LD++ERA+ D ++ K + +V G A E L
Sbjct: 213 LLNGYALNTGRAAQGMLMKVAPARVACLDFNLQKTKMQLGVQVLVTDPRELDKIRQREADMTKERIEKLLKAGANVVLTTKGIDDMALKYFVEAGAIAVRRVRKEDMRHVAKATGATLVSTFADMEGEETFEPSFLGYADEVVEERIADDDVILIKGTKNTSAVS-LVLRGANDYMLDEMERALHDALSIVKRTLESNTVVAGGGAVESAL 422

POPTR_0002s143604.20e-1324.17%POPTR_0002s14360.1
HSP 1
Score: 71.633 bits (174), Expect = 4.20041e-13
Identity = 51/211 (24.17%), Postives = 100/211 (47.39%), Query Frame = 2
Query:    8 IVQGMVLKTD--AVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDD------LGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
++ G L T A G +V A++A + + + VL+ +LE + E +E I + ++GA V+++ + +MAL + + ++ K ++R + TGA + ++ LG+ D V+ E I V +++ + ++VS ++LRG+ D +LD++ERA+ D ++ K + +V G A E L
Sbjct: 213 LLNGYALNTGRAAQGMPMKVAAARIACLDFNLQKTKMQLGVQVLVTDPRELEKIRQREADMTKERIGKLLKAGANVVLTTKGIDDMALKYFVEAGAIAVRRVRKEDMRHVAKATGATLVSTFADMEGEETFESSLLGYADEVAEERIADDDVIMIKGTKTTSAVS-LILRGANDYMLDEMERALHDALSIVKRTLESNMVVAGGGAVESAL 422

POPTR_0009s159102.55e-1019.15%POPTR_0009s15910.1
HSP 1
Score: 62.3882 bits (150), Expect = 2.5483e-10
Identity = 36/188 (19.15%), Postives = 86/188 (45.74%), Query Frame = 2
Query:   53 KRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
K+ K+ + ++ + + + + Q ++ E + + + A+SGAK+++S ++G++A + + S+ +L+R TG + + LG + +++G R + G + +T+VLRG D +++ ER++ D + + ++S +V G A ++E+
Sbjct: 233 KKFVNPKILLLNIELELKSEKENAEIRLSDPSQYQSIVDAEWNIIYDKLDKCAQSGAKIVLSRLAIGDLATQYFADRDIFCAGRVSEEDLQRVAAATGGTVQTTINNVIDEVLGTCEIFEEKQVGNERFNIFNGCPSG-TTATIVLRGGADQFIEEAERSLHDAIMIVRRAMKNSTVVAGGGAIDMEI 419

POPTR_0001s357901.26e-0923.38%POPTR_0001s35790.1
HSP 1
Score: 60.077 bits (144), Expect = 1.26471e-09
Identity = 47/201 (23.38%), Postives = 84/201 (41.79%), Query Frame = 2
Query:   14 QGMVL-KTDAVGSIKRVEKAKVAVFAGGVDTSATETKGT-VLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEI 610
+G +L K VG KR+E AK+ V +DT + G V + S ++ E+ K++E + + G V+ + ++ ++ + + R TG P LGH + IG ++ E G + T+VLRG++ +LD+ ER++ D + DSR++ G E+
Sbjct: 210 EGFILDKKIGVGQPKRIENAKILVANTAMDTDKVKIYGARVRVDSMSRVAEIEAAEKGKMKEKVDKIIAHGINCFVNRQLIYNFPEELFANAGILAIEHADFDGIERLALVTGGEIASTFDNPESVKLGHCKLIEEIMIGEDKLIHFSGVEMGQAC-TIVLRGASRHVLDEAERSLHDALCVLSQTVNDSRVLLGGGWPEM 409

POPTR_0006s130502.16e-0922.89%POPTR_0006s13050.1
HSP 1
Score: 59.3066 bits (142), Expect = 2.15727e-09
Identity = 46/201 (22.89%), Postives = 84/201 (41.79%), Query Frame = 2
Query:   14 QGMVL-KTDAVGSIKRVEKAKVAVFAGGVDTSATETKGT-VLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEI 610
+G +L K VG KR+E AK+ V +DT + G V + S ++ E+ K++E + + G ++ + ++ ++ + + R TG P LGH + IG ++ E G + T+VLRG++ +LD+ ER++ D + DSR++ G E+
Sbjct: 211 EGFILDKKIGVGQPKRIENAKILVANTAMDTDKVKIYGARVRVDSMSRVAEIEAAEKQKMKEKVDKIIAHGINCFINRQLIYNFPEELFANAGILAIEHADFDGIERLALVTGGEIASTFDNPESVKLGHCKLIEEIMIGEDKLIHFSGVEMGQAC-TIVLRGASRHVLDEAERSLHDALCVLSQTVNDSRVLLGGGWPEM 410

POPTR_0004s206208.20e-0918.62%POPTR_0004s20620.1
HSP 1
Score: 57.3806 bits (137), Expect = 8.1976e-09
Identity = 35/188 (18.62%), Postives = 85/188 (45.21%), Query Frame = 2
Query:   53 KRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
K+ K+ + ++ + + + + Q ++ E + + + +SGAKV++S ++G++A + + S+ +L+R +G + + LG + +++G R + G + +T+VLRG D +++ ER++ D + + ++S +V G A ++E+
Sbjct: 233 KKFVNPKMLLLNIELELKSEKENAEIRLSDPSQYQSIVDAEWNIIYDKLDKCVQSGAKVVLSRLAIGDLATQYFADRDIFCAGRVSEEDLQRVSAASGGTVQTTVNNIIDEVLGTCEIFEEKQVGNERFNIFSGCPSGRT-ATIVLRGGADQFIEEAERSLHDAIMIVRRAMKNSTVVAGGGAIDMEI 419

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CF810752
Best 10 Hits Shown

Match Name E value Identity Description
ppa026770m 1.19e-10291.22%ppa026770m
HSP 1
Score: 368.622 bits (945), Expect = 1.19141e-102
Identity = 187/205 (91.22%), Postives = 201/205 (98.05%), Query Frame = 2
Query:    2 CTIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
CT+V+GMVLKTDAVGSIKR+EKAKVAVF GVDTSATETKGTVLIHSA+QLENY+KTEEAKVEELIKAVA+SGAKVIVSG +VGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVA+LKLG+P+PDDLG+VDSVSVEEI GVRVTVV+NEEGGNSVSTV+LRGSTDSILDDLERAVDDGVNTYKAMC+DSRIVPGAAATEIEL
Sbjct: 213 CTVVRGMVLKTDAVGSIKRMEKAKVAVFVSGVDTSATETKGTVLIHSADQLENYAKTEEAKVEELIKAVADSGAKVIVSGAAVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVAMLKLGQPNPDDLGYVDSVSVEEIAGVRVTVVKNEEGGNSVSTVLLRGSTDSILDDLERAVDDGVNTYKAMCKDSRIVPGAAATEIEL 417

ppa003903m 3.47e-10290.73%ppa003903m
HSP 1
Score: 367.081 bits (941), Expect = 3.46647e-102
Identity = 186/205 (90.73%), Postives = 201/205 (98.05%), Query Frame = 2
Query:    2 CTIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
CT+V+GMVLKTDAVGSIKR+EKAKVAVF GVDTSATETKGTVLIHSA+QLENY+KTEEAKVEELIKAVA+SGAKVIVSG +VGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVA+LKLG+P+PDDLG+VDSVSVEEI GVRVTVV+NEEGGNSVSTV+LRGST+SILDDLERAVDDGVNTYKAMC+DSRIVPGAAATEIEL
Sbjct: 213 CTVVRGMVLKTDAVGSIKRMEKAKVAVFVSGVDTSATETKGTVLIHSADQLENYAKTEEAKVEELIKAVADSGAKVIVSGAAVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVAMLKLGQPNPDDLGYVDSVSVEEIAGVRVTVVKNEEGGNSVSTVLLRGSTESILDDLERAVDDGVNTYKAMCKDSRIVPGAAATEIEL 417

ppa004006m 10.00e-1723.81%ppa004006m
HSP 1
Score: 83.1889 bits (204), Expect = 9.99818e-17
Identity = 50/210 (23.81%), Postives = 102/210 (48.57%), Query Frame = 2
Query:   11 VQGMVLK---TDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGS-----VGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
V+G+V + A G R+E AK+AV + T+ + ++++ Q++ K E + +IK + +G V++ S V +++LH+ + K++V+K + E+ +T + + + + LGH D V +G ++ + + +TV++RGS +LD+ ER++ D + + + ++ G A EIEL
Sbjct: 219 VKGLVFDKKASHAAGGPTRMENAKIAVIQFQISPPKTDIEQSIVVSDYTQMDRILKEERNYILGMIKKIKATGCNVLLIQKSILRDAVTDLSLHYLAKAKILVIKDVERDEIEFITKTLNCLPIANIEHFRAEKLGHADLVEEVSLGDGKIVKITGIQNMGRTTTVLVRGSNQLVLDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIEL 428

ppa003729m 7.92e-1425.12%ppa003729m
HSP 1
Score: 73.559 bits (179), Expect = 7.92203e-14
Identity = 53/211 (25.12%), Postives = 99/211 (46.92%), Query Frame = 2
Query:    8 IVQGMVLKTD--AVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDD------LGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
++ G L T A G RV A++A + + + VL+ +LE + E +E I+ + ++GA VI++ + +MAL + + ++ K ++R + TGA + ++ LG D V E I V +++ + ++VS ++LRG+ D +LD++ERA+ D ++ K + +V G A E L
Sbjct: 213 LLTGYALNTGRAAQGMPLRVAPARIACLDFNLQKTKMQMGVQVLVSDPRELEKIRQREADMTKERIEKLLKAGANVILTTKGIDDMALKYFVEAGAIAVRRVQKEDMRHVAKATGATMVSTFADMEGEETFDSSLLGSADEVVEERISDDDVILIKGTKNNSAVS-LILRGANDYMLDEMERALHDALSIVKRTLESNSVVAGGGAVESAL 422

ppa004022m 1.40e-1021.93%ppa004022m
HSP 1
Score: 62.7734 bits (151), Expect = 1.39837e-10
Identity = 41/187 (21.93%), Postives = 84/187 (44.92%), Query Frame = 2
Query:   53 KRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNS-VSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEI 610
KR+E AK+A+ + +TK V I + E+ + E+ +++++ + GA +++ + A H L ++ EL TG + + +PD LG V + G + ++ E NS T+ +RG ++++ +R++ D + + + R++ IV G + EI
Sbjct: 237 KRIENAKIAILTCPFEPPKPKTKHKVDIDTVEKFQTLRLQEQKYFDDMVQQCKDVGATLVICQWGFDDEANHLLMHRNLPAVRWVGGVELELIAIATGGRIVPRFQELTPDKLGKAGIVREKSFGTTKDRMLYIEHCANSRAVTIFIRGGNKMMIEETKRSIHDALCVARNLIRNNSIVYGGGSAEI 423

ppa004143m 2.64e-0922.89%ppa004143m
HSP 1
Score: 58.5362 bits (140), Expect = 2.63721e-09
Identity = 46/201 (22.89%), Postives = 85/201 (42.29%), Query Frame = 2
Query:   14 QGMVL-KTDAVGSIKRVEKAKVAVFAGGVDTSATETKGT-VLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEI 610
+G +L K +G KR+E AK+ V +DT + G V + S ++ E+ K+ E ++ + G V+ + ++ ++ + + R TG P LGH + + IG ++ E G + T+VLRG++ +LD+ ER++ D + DSR++ G E+
Sbjct: 211 EGFILDKKIGLGQPKRIENAKILVANTAMDTDKVKIYGARVRVDSMSKVAEIEGAEKEKMREKVQKIIAHGINCFVNRQLIYNFPEEIFADAGILAIEHADFDGIERLALVTGGEIASTFDNPESVKLGHCNLIEEIMIGEDKLIHFSGVELGQAC-TIVLRGASHHVLDEAERSLHDALCVLSQTVNDSRVLLGGGWPEM 410

ppa004060m 3.44e-0918.28%ppa004060m
HSP 1
Score: 58.151 bits (139), Expect = 3.4443e-09
Identity = 34/186 (18.28%), Postives = 83/186 (44.62%), Query Frame = 2
Query:   53 KRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEI 610
K+ K+ + ++ + + + + Q ++ E + + + +SGAKV++S ++G++A + + ++ +L+R TG + + LG + +++G R + G + +T+VLRG D +++ ER++ D + + ++S +V G A ++
Sbjct: 233 KKFLNPKILLLNIELELKSEKENAEIRLSDPSQYQSIVDAEWNIIYDKLDKCVQSGAKVVLSRLAIGDLATQYFADRDIFCAGRVTEEDLQRVAAATGGTVQTSINNVIDEVLGTCECFEEKQVGNERFNIFSGCPSGRT-ATIVLRGGADQFIEEAERSLHDAIMIVRRALKNSTVVAGGGAIDV 417

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CF810752
Best 10 Hits Shown

Match Name E value Identity Description
TCPQ_DICDI1.63e-5751.23%
T-complex protein 1 subunit theta OS=Dic...
HSP 1
Score: 222.246 bits (565), Expect = 1.63476e-57
Identity = 104/203 (51.23%), Postives = 149/203 (73.40%), Query Frame = 2
Query:    5 TIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIE 613
++++G V+ DA G+IKR+EKAK+AVF G+D TET G VLI + ++L +SK EE + E I A+A +G KVI+SG +V E+ALH+ ER+K+M+++I SKF+LRR C+ GA L+KLG P P++LG+ D V VEEIG + + R + + +ST+V+RGST++ILDD+ERA+DDGVN +K MC+D R + GA A EIE
Sbjct: 210 SVIKGFVIPMDAEGTIKRMEKAKIAVFTMGIDLGRTETTGKVLITNEDELLQFSKGEEDSIRETITAIANTGVKVIISGSTVSELALHYIERFKIMLVRIQSKFQLRRVCKAIGATPLVKLGAPIPEELGYCDEVLVEEIGSTKCCIFRQNKEESEISTIVVRGSTNNILDDIERAIDDGVNVFKGMCKDGRFLAGAGAFEIE 412

TCPQ_BOVIN1.38e-5650.00%
T-complex protein 1 subunit theta OS=Bos...
HSP 1
Score: 219.164 bits (557), Expect = 1.38391e-56
Identity = 102/204 (50.00%), Postives = 153/204 (75.00%), Query Frame = 2
Query:    5 TIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
+++ GMV K + G + V+ AK+AV++ D TETKGTVLI SAE+L N+SK EE ++ +KA+A++GA V+V+GG V +MALH+ +Y +M+++++SK++LRR C+T GA AL +L P +++GH DSV + E+G +V V ++E+ ++ST+VLRGSTD+++DD+ERAVDDGVNT+K + RD R+VPG ATEIEL
Sbjct: 216 SVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKSAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGRVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLNPPVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIEL 419

TCPQ_MACFA1.81e-5649.51%
T-complex protein 1 subunit theta OS=Mac...
HSP 1
Score: 218.779 bits (556), Expect = 1.80744e-56
Identity = 101/204 (49.51%), Postives = 154/204 (75.49%), Query Frame = 2
Query:    5 TIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
+++ GMV K + G + V+ AK+AV++ D + TETKGTVLI +AE+L N+SK EE ++ +KA+A++GA V+V+GG V +MALH+ +Y +M+++++SK++LRR C+T GA AL +L P +++GH DSV + E+G +V V ++E+ ++ST+VLRGSTD+++DD+ERAVDDGVNT+K + RD R+VPG ATEIEL
Sbjct: 216 SVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGTITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVCLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIEL 419

TCPQ_PONAB4.03e-5649.51%
T-complex protein 1 subunit theta OS=Pon...
HSP 1
Score: 217.624 bits (553), Expect = 4.02655e-56
Identity = 101/204 (49.51%), Postives = 153/204 (75.00%), Query Frame = 2
Query:    5 TIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
+++ GMV K + G + V+ AK+AV++ D TETKGTVLI +AE+L N+SK EE ++ +KA+A++GA V+V+GG V +MALH+ +Y +M+++++SK++LRR C+T GA AL +L P +++GH DSV + E+G +V V ++E+ ++ST+VLRGSTD+++DD+ERAVDDGVNT+K + RD R+VPG ATEIEL
Sbjct: 216 SVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIEL 419

TCPQ_HUMAN4.03e-5649.51%
T-complex protein 1 subunit theta OS=Hom...
HSP 1
Score: 217.624 bits (553), Expect = 4.02655e-56
Identity = 101/204 (49.51%), Postives = 153/204 (75.00%), Query Frame = 2
Query:    5 TIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
+++ GMV K + G + V+ AK+AV++ D TETKGTVLI +AE+L N+SK EE ++ +KA+A++GA V+V+GG V +MALH+ +Y +M+++++SK++LRR C+T GA AL +L P +++GH DSV + E+G +V V ++E+ ++ST+VLRGSTD+++DD+ERAVDDGVNT+K + RD R+VPG ATEIEL
Sbjct: 216 SVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADMALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIEL 419

TCPQ_MOUSE6.87e-5650.00%
T-complex protein 1 subunit theta OS=Mus...
HSP 1
Score: 216.853 bits (551), Expect = 6.86826e-56
Identity = 102/204 (50.00%), Postives = 152/204 (74.51%), Query Frame = 2
Query:    5 TIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
+++ GMV K + G + V+ AK+AV++ D TETKGTVLI +AE+L N+SK EE ++ +KA+A +GA VIV+GG V ++ALH+ +Y +M+++++SK++LRR C+T GA AL KL P +++GH DSV + E+G +V V ++E+ ++ST+VLRGSTD+++DD+ERAVDDGVNT+K + RD R+VPG ATEIEL
Sbjct: 216 SVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIAGTGANVIVTGGKVADIALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPKLTPPVQEEMGHCDSVYLSEVGDTQVVVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIEL 419

TCPQ_CHICK7.59e-5548.53%
T-complex protein 1 subunit theta OS=Gal...
HSP 1
Score: 213.386 bits (542), Expect = 7.59375e-55
Identity = 99/204 (48.53%), Postives = 152/204 (74.51%), Query Frame = 2
Query:    5 TIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
+++ GMV + G + V+ AK AV++ D TETKGTVLI +AE+L N+SK EE ++ +KA+A+SGA V+V+GG V +MALH+ +Y LM+++++SK++LRR C+T GA AL +L P+ +++GH +SV + E+G +V V ++E+ ++ST+++RGSTD+++DD+ERAVDDGVNT+K + RD R+VPG ATEIEL
Sbjct: 216 SVLHGMVFNKETEGDVTSVKDAKXAVYSCPFDGMITETKGTVLIKNAEELMNFSKGEENLMDLQVKAIADSGANVVVTGGKVADMALHYANKYNLMIVRLNSKWDLRRLCKTVGATALPRLTPPTLEEMGHCNSVYLSEVGDTQVVVFKHEKEDGAISTILIRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIEL 419

TCPQ_CAEEL3.19e-5349.02%
T-complex protein 1 subunit theta OS=Cae...
HSP 1
Score: 207.994 bits (528), Expect = 3.19043e-53
Identity = 100/204 (49.02%), Postives = 145/204 (71.08%), Query Frame = 2
Query:    5 TIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
T++ GMV K A G I+ A++AV+ D + TETKGTVLI +A++L N+SK EEA+VEE +KA+A++G KV+V+ G G+M LHF +YK+M ++++SKF+LRR CRT GA ++ P+ + LGH DSV+V+EIG V V + V+T+++RGS+ S +DD+ERAVDD VNTYKA+ +D +++ GA A EIEL
Sbjct: 216 TVMNGMVFKRGAEGEIREARDARIAVYTCPFDLTQTETKGTVLIENADELRNFSKGEEAEVEEQVKAIADNGVKVVVAAGKFGDMYLHFLNKYKIMAVRLTSKFDLRRLCRTVGAQPQARICAPAVNLLGHCDSVAVQEIGDENVVVFDKKSETGKVATIIIRGSSQSRIDDVERAVDDAVNTYKALTKDGKLLAGAGAVEIEL 419

TCPQ_CAEBR1.03e-5148.28%
T-complex protein 1 subunit theta OS=Cae...
HSP 1
Score: 202.986 bits (515), Expect = 1.02633e-51
Identity = 98/203 (48.28%), Postives = 143/203 (70.44%), Query Frame = 2
Query:    8 IVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
++ GMV K A G I+ + A++AV+ D + TETKGTVLI +A++L N+SK EE++VEE +KA+A++G KV+V+ G G++ LHF +YK+M ++++SKF+LRR CRT GA ++ P+ + LGH DSVSV EIG V V V+T+++RGS+ S +DD+ERAVDD VNTYKA+ +D +++ GA A EIEL
Sbjct: 217 VMNGMVFKRGAEGEIRSAQDARIAVYTCPFDLTQTETKGTVLIENADELVNFSKGEESEVEEQVKAIADNGVKVVVAAGKFGDLYLHFLNKYKIMAVRLTSKFDLRRLCRTVGAQPQARICAPAVNLLGHCDSVSVTEIGDENVVVFDKNSETGKVATIIIRGSSQSRIDDVERAVDDAVNTYKALTKDGKLLAGAGAVEIEL 419

TCPQ_SCHPO2.99e-5146.80%
Probable T-complex protein 1 subunit the...
HSP 1
Score: 201.445 bits (511), Expect = 2.98615e-51
Identity = 95/203 (46.80%), Postives = 148/203 (72.91%), Query Frame = 2
Query:    8 IVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
+V+GMV + G++ R ++AKVAVF+ +D S TETKGTVL+H+A+++ ++SK EE +E IK + ++G +V+V+ G+V ++ LH+ R++++V+++ SKFELRR CR GA L ++G P P+++G VD V EIGG RVTV R E +T+VLRG+T + LDDLERA+DDGVN KA+ +D+R++ GA A++++L
Sbjct: 217 VVKGMVFPREPEGTVTRSKEAKVAVFSCPLDISQTETKGTVLLHNAQEMLDFSKGEENLIESHIKEIYDAGVRVVVTSGNVNDLVLHYLNRFEILVIRVPSKFELRRLCRVVGATPLARMGVPMPEEMGSVDVVETIEIGGDRVTVFRQVEDITRTATIVLRGATKTYLDDLERAIDDGVNIVKALVKDNRLIFGAGASDMQL 419

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CF810752
Best 10 Hits Shown

Match Name E value Identity Description
D7TI60_VITVI1.39e-10192.20%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 372.474 bits (955), Expect = 1.38632e-101
Identity = 189/205 (92.20%), Postives = 201/205 (98.05%), Query Frame = 2
Query:    2 CTIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
CT+V+GM LKTDAVGSIKRVEKAKVAVFA GVDTSATETKGTVLIHSAEQLENY+KTEEAK+EELIKAVA+SGAKVIVSGG+VGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVA+LKL +P+PDDLG+VDSVSVEEIGGVRVT+V+NEEGGNSV TVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL
Sbjct: 217 CTVVRGMALKTDAVGSIKRVEKAKVAVFASGVDTSATETKGTVLIHSAEQLENYAKTEEAKIEELIKAVADSGAKVIVSGGAVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVAVLKLSQPNPDDLGYVDSVSVEEIGGVRVTIVKNEEGGNSVCTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 421

D7LXS6_ARALY1.17e-10093.10%
Predicted protein OS=Arabidopsis lyrata ...
HSP 1
Score: 369.392 bits (947), Expect = 1.17359e-100
Identity = 189/203 (93.10%), Postives = 199/203 (98.03%), Query Frame = 2
Query:    8 IVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
IV+GMVLK+DA+GSIKR+EKAKVAVFA GVDT+ATETKGTVLIHSAEQLENY+KTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVA LKL RPSPDDLG+VDS+SVEEIGGVRVT+ RNEEGGNS+STVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL
Sbjct: 219 IVRGMVLKSDAIGSIKRMEKAKVAVFADGVDTTATETKGTVLIHSAEQLENYAKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVAQLKLNRPSPDDLGYVDSISVEEIGGVRVTIARNEEGGNSISTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 421

D7L202_ARALY7.61e-10092.12%
Putative uncharacterized protein OS=Arab...
HSP 1
Score: 366.696 bits (940), Expect = 7.60697e-100
Identity = 187/203 (92.12%), Postives = 198/203 (97.54%), Query Frame = 2
Query:    8 IVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
IV+GMVLK+DAVGSIKR+EKAKVAVFAGGVDT+ATETKGTVLIHSAEQLENY+KTEEAKVEELIKAVAESGAKVIVSGGS+GEMALHFCERYK+MVLKISSKFELRRFCRT GAVA LKL RPSPDDLG+VDS+SVEEIGGV VT+ RNEEGGNS+STVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL
Sbjct: 217 IVRGMVLKSDAVGSIKRMEKAKVAVFAGGVDTTATETKGTVLIHSAEQLENYAKTEEAKVEELIKAVAESGAKVIVSGGSIGEMALHFCERYKIMVLKISSKFELRRFCRTAGAVAHLKLSRPSPDDLGYVDSISVEEIGGVTVTIARNEEGGNSISTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 419

Q9SQR6_ARATH2.21e-9991.63%
Putative T-complex protein 1, theta subu...
HSP 1
Score: 365.155 bits (936), Expect = 2.21329e-99
Identity = 186/203 (91.63%), Postives = 198/203 (97.54%), Query Frame = 2
Query:    8 IVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
IV+GMVLK+DAVGSIKR+EKAKVAVFAGGVDT+ATETKGTVLIHSAEQLENY+KTEEAKVEELIKAVAESGAKVIVSGGS+GEMALHFCERYK+MVLKISSKFELRRFCRT GAVA LKL RPSP+DLG+VDS+SVEEIGGV VT+ RNEEGGNS+STVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL
Sbjct: 220 IVRGMVLKSDAVGSIKRMEKAKVAVFAGGVDTTATETKGTVLIHSAEQLENYAKTEEAKVEELIKAVAESGAKVIVSGGSIGEMALHFCERYKIMVLKISSKFELRRFCRTAGAVAHLKLSRPSPEDLGYVDSISVEEIGGVTVTIARNEEGGNSISTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 422

Q94K05_ARATH2.21e-9991.63%
At3g03960 OS=Arabidopsis thaliana GN=At3...
HSP 1
Score: 365.155 bits (936), Expect = 2.21329e-99
Identity = 186/203 (91.63%), Postives = 198/203 (97.54%), Query Frame = 2
Query:    8 IVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
IV+GMVLK+DAVGSIKR+EKAKVAVFAGGVDT+ATETKGTVLIHSAEQLENY+KTEEAKVEELIKAVAESGAKVIVSGGS+GEMALHFCERYK+MVLKISSKFELRRFCRT GAVA LKL RPSP+DLG+VDS+SVEEIGGV VT+ RNEEGGNS+STVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL
Sbjct: 220 IVRGMVLKSDAVGSIKRMEKAKVAVFAGGVDTTATETKGTVLIHSAEQLENYAKTEEAKVEELIKAVAESGAKVIVSGGSIGEMALHFCERYKIMVLKISSKFELRRFCRTAGAVAHLKLSRPSPEDLGYVDSISVEEIGGVTVTIARNEEGGNSISTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 422

A9NV11_PICSI1.87e-9888.78%
Putative uncharacterized protein OS=Pice...
HSP 1
Score: 362.073 bits (928), Expect = 1.87366e-98
Identity = 182/205 (88.78%), Postives = 196/205 (95.61%), Query Frame = 2
Query:    2 CTIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
CT+V+GMVLK DAVG+IK +EKAKVAVF GG+DTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVA+SGAKVIVSGG+VGEMALHFCERYKLMVLKISSKFELRRFCRTTGAV+L+KLG+P PD+LG DSVSVEEIGGVRVT+V+NEEGGN VSTVVLRGSTDSILDDLERAVDDGVN YKAMCRDSRI+PGA ATEIEL
Sbjct: 217 CTVVRGMVLKNDAVGTIKHIEKAKVAVFGGGIDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVADSGAKVIVSGGAVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVSLVKLGQPGPDELGFADSVSVEEIGGVRVTIVKNEEGGNLVSTVVLRGSTDSILDDLERAVDDGVNNYKAMCRDSRILPGAGATEIEL 421

B9I5Y4_POPTR7.12e-9890.69%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 360.147 bits (923), Expect = 7.11991e-98
Identity = 185/204 (90.69%), Postives = 195/204 (95.59%), Query Frame = 2
Query:    5 TIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
+IV+GMVLK D VG+IKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENY+KTEEAKVEELIKAVAE+GAKVIVSG +VGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVA+LKL PSPDDLG VDS+SVEEIGG RVT+VRNEEGGNSV TVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRI+PG AATEIEL
Sbjct: 218 SIVRGMVLKGDTVGTIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYAKTEEAKVEELIKAVAETGAKVIVSGAAVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVAILKLSPPSPDDLGCVDSISVEEIGGARVTIVRNEEGGNSVCTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIIPGGAATEIEL 421

A9PG05_POPTR7.12e-9890.69%
Putative uncharacterized protein OS=Popu...
HSP 1
Score: 360.147 bits (923), Expect = 7.11991e-98
Identity = 185/204 (90.69%), Postives = 195/204 (95.59%), Query Frame = 2
Query:    5 TIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
+IV+GMVLK D VG+IKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENY+KTEEAKVEELIKAVAE+GAKVIVSG +VGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVA+LKL PSPDDLG VDS+SVEEIGG RVT+VRNEEGGNSV TVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRI+PG AATEIEL
Sbjct: 218 SIVRGMVLKGDTVGTIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYAKTEEAKVEELIKAVAETGAKVIVSGAAVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVAILKLSPPSPDDLGCVDSISVEEIGGARVTIVRNEEGGNSVCTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIIPGGAATEIEL 421

Q75HJ3_ORYSJ3.53e-9788.24%
Os03g0804800 protein OS=Oryza sativa sub...
HSP 1
Score: 357.836 bits (917), Expect = 3.53357e-97
Identity = 180/204 (88.24%), Postives = 198/204 (97.06%), Query Frame = 2
Query:    5 TIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
++V+GMVLK DAVGSIKRVEKAK+AVFAGGVDTSATETKGTVLIHSAEQLENY+KTEEAKVEELIKAVA+SGAKVIVSG +VG+MALHFCERYKLMVL+ISSKFELRRFCRTTG++ALLKL RP+ D+LG+ DSVSVEEIGG RVTVV+NEEGGNSV+TVVLRGSTDSILDDLERAVDDGVNTYK+MCRDSRI+PGAAATEIEL
Sbjct: 220 SVVRGMVLKNDAVGSIKRVEKAKIAVFAGGVDTSATETKGTVLIHSAEQLENYAKTEEAKVEELIKAVADSGAKVIVSGAAVGDMALHFCERYKLMVLRISSKFELRRFCRTTGSIALLKLSRPNADELGYADSVSVEEIGGARVTVVKNEEGGNSVATVVLRGSTDSILDDLERAVDDGVNTYKSMCRDSRIIPGAAATEIEL 423

C6F1N7_ORYSJ3.53e-9788.24%
TCP-1/cpn60 chaperonin OS=Oryza sativa s...
HSP 1
Score: 357.836 bits (917), Expect = 3.53357e-97
Identity = 180/204 (88.24%), Postives = 198/204 (97.06%), Query Frame = 2
Query:    5 TIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
++V+GMVLK DAVGSIKRVEKAK+AVFAGGVDTSATETKGTVLIHSAEQLENY+KTEEAKVEELIKAVA+SGAKVIVSG +VG+MALHFCERYKLMVL+ISSKFELRRFCRTTG++ALLKL RP+ D+LG+ DSVSVEEIGG RVTVV+NEEGGNSV+TVVLRGSTDSILDDLERAVDDGVNTYK+MCRDSRI+PGAAATEIEL
Sbjct: 220 SVVRGMVLKNDAVGSIKRVEKAKIAVFAGGVDTSATETKGTVLIHSAEQLENYAKTEEAKVEELIKAVADSGAKVIVSGAAVGDMALHFCERYKLMVLRISSKFELRRFCRTTGSIALLKLSRPNADELGYADSVSVEEIGGARVTVVKNEEGGNSVATVVLRGSTDSILDDLERAVDDGVNTYKSMCRDSRIIPGAAATEIEL 423

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CF810752
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010333940017.06e-10492.20%GSVIVT01033394001 assembled CDS
HSP 1
Score: 372.474 bits (955), Expect = 7.05777e-104
Identity = 189/205 (92.20%), Postives = 201/205 (98.05%), Query Frame = 2
Query:    2 CTIVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
CT+V+GM LKTDAVGSIKRVEKAKVAVFA GVDTSATETKGTVLIHSAEQLENY+KTEEAK+EELIKAVA+SGAKVIVSGG+VGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVA+LKL +P+PDDLG+VDSVSVEEIGGVRVT+V+NEEGGNSV TVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL
Sbjct: 217 CTVVRGMALKTDAVGSIKRVEKAKVAVFASGVDTSATETKGTVLIHSAEQLENYAKTEEAKIEELIKAVADSGAKVIVSGGAVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVAVLKLSQPNPDDLGYVDSVSVEEIGGVRVTIVKNEEGGNSVCTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 421

GSVIVT010083630014.69e-1523.47%GSVIVT01008363001 assembled CDS
HSP 1
Score: 77.411 bits (189), Expect = 4.69293e-15
Identity = 46/196 (23.47%), Postives = 94/196 (47.96%), Query Frame = 2
Query:   44 GSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGS-----VGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
G RVE AK+AV + T+ + ++++ Q++ K E + +IK + +G V++ S V +++LH+ + K++V+K + E+ +T + + + + LG D V +G ++ + + +TV++RGS +LD+ ER++ D + + + ++ G A EIEL
Sbjct: 31 GGPTRVENAKIAVIQFQISPPKTDIEQSIVVSDYTQMDRILKEERNYILGMIKKIKATGCNVLLIQKSILRDAVTDLSLHYLAKAKILVIKDVERDEIEFITKTLNCLPIANIEHFRAEKLGFADCVEEVSLGDGKIVKITGIKDMGRTTTVLVRGSNMLVLDEAERSLHDALCVVRCLVNKRFLIAGGGAPEIEL 226

GSVIVT010182130011.16e-1324.64%GSVIVT01018213001 assembled CDS
HSP 1
Score: 72.7886 bits (177), Expect = 1.15591e-13
Identity = 52/211 (24.64%), Postives = 99/211 (46.92%), Query Frame = 2
Query:    8 IVQGMVLKTD--AVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDD------LGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
++ G L T A G RV A++A + + + VL+ +LE + E +E I+ + ++GA V+++ + +MAL + + ++ K ++R + TGA + D+ LG+ D V E I V +++ + + VS ++LRG+ D +LD+++RA+ D ++ K + +V G A E L
Sbjct: 213 LLNGYALNTGRAAQGMPLRVAPARIACLDFNLQRTKMQLGVQVLVTDPRELEKIRQREADMTKERIEKLLKAGANVVLTTKGIDDMALKYFVEAGAIAVRRVRKDDMRHVAKATGATMVSTFADMEGDETFDSSFLGYADEVVEERIADDDVIMIKGTKTTSGVS-LILRGANDYMLDEMDRALHDALSIVKRTLESNTVVAGGGAVEAAL 422

GSVIVT010077700016.56e-0920.00%GSVIVT01007770001 assembled CDS
HSP 1
Score: 56.9954 bits (136), Expect = 6.56364e-09
Identity = 41/205 (20.00%), Postives = 98/205 (47.80%), Query Frame = 2
Query:    8 IVQGMVLKTDAV--GSIKR-VEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSV-SVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEI 610
+++G+++ D V G ++R + ++ + ++ E + + E K EE +E L + + ++++ + ++A H+ + + ++ K + R + GAV + + D+G + V++IG + +E TV+LRG++ +L+++ER + D ++ + M ++ ++VPG ATE+
Sbjct: 213 VLKGVMINKDVVAPGKMRRKIINPRIILLDCPLEYKKGENQTNAELVREEDWGILLKMEEEYIENLCMQILKFKPDLVITEKGLSDLACHYLSKAGVSAIRRLRKTDNNRIAKACGAVVVNRPDELQESDVGTRAGIFEVKKIGDEFFAFI-DECTDPKACTVLLRGASKDLLNEVERNLQDAMSVARNMIKNPKLVPGGGATEL 416

GSVIVT010022780016.56e-0923.08%GSVIVT01002278001 assembled CDS
HSP 1
Score: 56.9954 bits (136), Expect = 6.56364e-09
Identity = 33/143 (23.08%), Postives = 71/143 (49.65%), Query Frame = 2
Query:  188 EELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
++L K V +SGAK+++S ++G++A + + ++ +L+R TG + + LG + ++G R + G + +T+VLRG D +++ ER++ D + + ++S +V G A ++E+
Sbjct: 279 DKLDKCV-QSGAKIVLSRLAIGDLATQYFADRDIFCAGRVTEEDLQRVAAATGGTVQTTVNNIIDEVLGSCELFEERQVGNERFNIFSGCPSGQT-ATIVLRGGADQFIEEAERSLHDAIMIVRRALKNSTVVAGGGAIDMEI 419

GSVIVT010087080011.12e-0822.89%GSVIVT01008708001 assembled CDS
HSP 1
Score: 56.225 bits (134), Expect = 1.11959e-08
Identity = 46/201 (22.89%), Postives = 84/201 (41.79%), Query Frame = 2
Query:   14 QGMVL-KTDAVGSIKRVEKAKVAVFAGGVDTSATETKGT-VLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEI 610
+G +L K +G KR+E AK+ V +DT + G V + S ++ E+ K+ E ++ + G V+ + ++ ++ + + R TG P LGH + IG ++ E G + T+VLRG++ +LD+ ER++ D + DSR++ G E+
Sbjct: 211 EGFILDKKIGIGQPKRIENAKILVANTAMDTDKVKIYGARVRVDSMSRVAQIEGAEKEKMREKVQKIIGHGINCFVNRQLIYNFPEELFADAGVLAIEHADFDGIERLALVTGGEIASTFDNPESVKLGHCKLIEEIMIGEDKLIHFSGVEMGQAC-TIVLRGASFHVLDEAERSLHDALCVLSQTVIDSRVLLGGGWPEM 410

GSVIVT010002660018.02e-0718.05%GSVIVT01000266001 assembled CDS
HSP 1
Score: 50.0618 bits (118), Expect = 8.02351e-07
Identity = 37/205 (18.05%), Postives = 97/205 (47.32%), Query Frame = 2
Query:    8 IVQGMVLKTDAV--GSIKR-VEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSV-SVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEI 610
+++G+++ D + G ++R + ++ + ++ E + + E K EE +E + + + ++++ + ++A H+ + + ++ K + R + GAV + + D+G + V++IG + + + + TV+LRG + +L+++ER + D + + + ++ ++VPG ATE+
Sbjct: 213 VLKGVMINKDVIAPGKMRRKIVNPRIILLDCPLEYKKGENQTNAELVKEEDWGVLLKMEEEYIESICMQILKFKPDLVITEKGLSDLACHYLSKAGVSAIRRLRKTDNNRIAKACGAVIVNRPDELQESDVGTGAGLFEVKKIGDEFFAFIVDCKDPKAC-TVLLRGPSKDLLNEVERNLQDAMCVARNIIKNPKLVPGGGATEL 416

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CF810752
Best 10 Hits Shown

Match Name E value Identity Description
AT3G03960.1 1.62e-10191.63%
TCP-1/cpn60 chaperonin family protein |...
HSP 1
Score: 365.155 bits (936), Expect = 1.61919e-101
Identity = 186/203 (91.63%), Postives = 198/203 (97.54%), Query Frame = 2
Query:    8 IVQGMVLKTDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
IV+GMVLK+DAVGSIKR+EKAKVAVFAGGVDT+ATETKGTVLIHSAEQLENY+KTEEAKVEELIKAVAESGAKVIVSGGS+GEMALHFCERYK+MVLKISSKFELRRFCRT GAVA LKL RPSP+DLG+VDS+SVEEIGGV VT+ RNEEGGNS+STVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL
Sbjct: 220 IVRGMVLKSDAVGSIKRMEKAKVAVFAGGVDTTATETKGTVLIHSAEQLENYAKTEEAKVEELIKAVAESGAKVIVSGGSIGEMALHFCERYKIMVLKISSKFELRRFCRTAGAVAHLKLSRPSPEDLGYVDSISVEEIGGVTVTIARNEEGGNSISTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 422

AT3G18190.1 2.10e-1624.29%
TCP-1/cpn60 chaperonin family protein |...
HSP 1
Score: 82.4185 bits (202), Expect = 2.09634e-16
Identity = 51/210 (24.29%), Postives = 102/210 (48.57%), Query Frame = 2
Query:   11 VQGMVLK---TDAVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGS-----VGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
V+G+V + A G RVE AK+AV + T+ + ++++ Q++ K E + +IK + +G V++ S V +++LH+ + K+MV+K + E+ +T + + + + LGH D V +G ++ + + ++V++RGS +LD+ ER++ D + + + ++ G A EIEL
Sbjct: 220 VKGLVFDKKVSRAAGGPTRVENAKIAVIQFQISPPKTDIEQSIVVSDYTQMDRILKEERNYILGMIKKIKATGCNVLLIQKSILRDAVTDLSLHYLAKAKIMVIKDVERDEIEFVTKTLNCLPIANIEHFRAEKLGHADLVEEASLGDGKILKITGIKDMGRTTSVLVRGSNQLVLDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIEL 429

AT4G08640.1 1.15e-1435.71%
ATP binding | chr4:5513313-5514174 FORW...
HSP 1
Score: 76.6406 bits (187), Expect = 1.1503e-14
Identity = 50/140 (35.71%), Postives = 74/140 (52.86%), Query Frame = 2
Query:    8 IVQGMVLKTDAVGSIKR-VEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEI 424
+V G+V K+D VG+I+ ++ AKV N+ K++EA +E L+K +A S KVIVS S+ EM L FC+ YK+MVL+ISS ++ C GA+ + P LG++DS S+ EI
Sbjct: 23 VVCGIVFKSDDVGNIRHPLKNAKV--------------------------HNFGKSKEAMLETLVKDIAFSNVKVIVSRSSICEMTLRFCKIYKIMVLQISSDIDINSLCSIVGAIDSSQ--HFQPHHLGYMDSTSLSEI 134

AT3G20050.1 9.74e-1425.59%
T-complex protein 1 alpha subunit | chr...
HSP 1
Score: 73.559 bits (179), Expect = 9.73789e-14
Identity = 54/211 (25.59%), Postives = 98/211 (46.45%), Query Frame = 2
Query:    8 IVQGMVLKTD--AVGSIKRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRP------SPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
++ G L T A G RV AK+A + + + V+++ +LE + E +E I+ + ++GA VI++ + +MAL + + ++ K ++R + TGA + P LG D V E I V +++ + ++VS ++LRG+ D +LD++ERA+ D + K + +V G A E L
Sbjct: 213 LLNGYALNTGRAAQGMPLRVSPAKIACLDFNLQKTKMQLGVQVVVNDPRELEKIRQREADMTKERIEKLLKAGANVILTTKGIDDMALKYFVEAGAIAVRRVRKEDMRHVAKATGATLVTTFADMEGEETFDPAHLGSADEVVEERIADDDVILIKGTKTSSAVS-LILRGANDYMLDEMERALHDALCIVKRTLESNTVVAGGGAVESAL 422

AT3G11830.1 1.32e-1019.68%
TCP-1/cpn60 chaperonin family protein |...
HSP 1
Score: 63.1586 bits (152), Expect = 1.31611e-10
Identity = 37/188 (19.68%), Postives = 85/188 (45.21%), Query Frame = 2
Query:   53 KRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEIEL 616
K+ K+ + ++ + + + + Q ++ E + + + ESGAKV++S ++G++A + + ++ +L R G + + LG + +++GG R + G + +T+VLRG D +++ ER++ D + + ++S +VPG A ++E+
Sbjct: 233 KKFLNPKILLLNIELELKSEKENAEIRLSDPSQYQSIVDAEWNIIYDKLDKCVESGAKVVLSRLAIGDLATQYFADRDIFCAGRVAEEDLNRVAAAAGGTVQTSVNNIIDEVLGTCEIFEEKQVGGERFNIFSGCPSGRT-ATIVLRGGADQFIEEAERSLHDAIMIVRRAVKNSTVVPGGGAIDMEI 419

AT3G11830.2 3.83e-1019.89%
TCP-1/cpn60 chaperonin family protein |...
HSP 1
Score: 61.6178 bits (148), Expect = 3.82931e-10
Identity = 37/186 (19.89%), Postives = 83/186 (44.62%), Query Frame = 2
Query:   53 KRVEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEI 610
K+ K+ + ++ + + + + Q ++ E + + + ESGAKV++S ++G++A + + ++ +L R G + + LG + +++GG R + G + +T+VLRG D +++ ER++ D + + ++S +VPG A +I
Sbjct: 233 KKFLNPKILLLNIELELKSEKENAEIRLSDPSQYQSIVDAEWNIIYDKLDKCVESGAKVVLSRLAIGDLATQYFADRDIFCAGRVAEEDLNRVAAAAGGTVQTSVNNIIDEVLGTCEIFEEKQVGGERFNIFSGCPSGRT-ATIVLRGGADQFIEEAERSLHDAIMIVRRAVKNSTVVPGGGAIDI 417

AT5G20890.1 1.04e-0721.89%
TCP-1/cpn60 chaperonin family protein |...
HSP 1
Score: 53.5286 bits (127), Expect = 1.04282e-07
Identity = 44/201 (21.89%), Postives = 84/201 (41.79%), Query Frame = 2
Query:   14 QGMVL-KTDAVGSIKRVEKAKVAVFAGGVDTSATETKGT-VLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSVSVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEI 610
+G +L K +G KR+E A + V +DT + G V + S ++ E+ K+++ +K + G V+ + ++ ++ + + R TG P LGH + IG ++ E G + S +VLRG++ +LD+ ER++ D + D+R++ G E+
Sbjct: 211 EGFILDKKIGIGQPKRIENANILVANTAMDTDKVKIYGARVRVDSMTKVAEIEGAEKEKMKDKVKKIIGHGINCFVNRQLIYNFPEELFADAGILAIEHADFEGIERLGLVTGGEIASTFDNPESVKLGHCKLIEEIMIGEDKLIHFSGCEMGQACS-IVLRGASHHVLDEAERSLHDALCVLSQTVNDTRVLLGGGWPEM 410

AT5G26360.1 2.32e-0719.02%
TCP-1/cpn60 chaperonin family protein |...
HSP 1
Score: 52.373 bits (124), Expect = 2.32316e-07
Identity = 39/205 (19.02%), Postives = 98/205 (47.80%), Query Frame = 2
Query:    8 IVQGMVLKTDAV--GSIKR-VEKAKVAVFAGGVDTSATETKGTVLIHSAEQLENYSKTEEAKVEELIKAVAESGAKVIVSGGSVGEMALHFCERYKLMVLKISSKFELRRFCRTTGAVALLKLGRPSPDDLGHVDSV-SVEEIGGVRVTVVRNEEGGNSVSTVVLRGSTDSILDDLERAVDDGVNTYKAMCRDSRIVPGAAATEI 610
+++G++ D V G +KR + ++ + ++ E + + E E K EE +E + + + ++++ + ++A H+ + + ++ K + R + GAV + + D+G + V++IG + + + + + TV+LRG + ++++ER + D ++ + + ++ ++VPG ATE+
Sbjct: 213 VLKGVMFNKDVVAPGKMKRKIVNPRIILLDCPLEYKKGENQTNAELVREEDWEVLLKLEEEYIENICVQILKFKPDLVITEKGLSDLACHYFSKAGVSAIRRLRKTDNNRIAKACGAVIVNRPDELQESDIGTGAGLFEVKKIGDDFFSFIVDCKEPKAC-TVLLRGPSKDFINEVERNLQDAMSVARNIIKNPKLVPGGGATEL 416

Related info for CF810752