CF810429

Information for CF810429

NameCF810429
AccessionID2213
Length617 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014530 cDNA cold acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CF810429
Sequence
CAAAGCTTCCATCTGCATTTCTACAAGTAATTTGTTGGGTCTTGGGGGAATATGGAACTG
CAGATGGGAAGTATTCAGCCTCTTATATCACAGGGAAGTTGTGTGACGTGGCAGAATCAC
ATTCCAGTGATGACACTGTAAAGGCATATGCAGTCGCAGCCCTAATGAAAATATATGCAT
TTGAGATTGCAGCTGGGAGAAAAGTGGACCTGCTACCCGAGTGCCAATCTTTAATTGAAG
AACTATCAGCATCACACTCAACAGATTTGCAACAGCGTGCTTATGAACTTCAAGCAGTCA
TCAGCTTGGATGCTCGTGCTGTTGAAAGTATAATGCCACTAGATGCAAGTTGTGAAGACA
TTGAGATTGATAAAAGCCTTTCATTCCTCAATAGTTTTGTCCAACAGTCATTGGAAAAGG
GTGCTCAACCCTATATTCCAGAGAATGAACGTTCTGGAGTTTTGGATGTTGCCAGCCTTA
GAAGCCAAGACCACCACGAAGCTTCAACACATTCTCTTAGGTTTGAGGCCTACGAGCTTC
CAAAACCAGTGATTCCATCAAGGGCTCCTCCTGTTTCAGTCTCCCATTCAACTGAACTTG
TTCCAGTACCAGAGCCT
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0006886 biological_process intracellular protein transport
GO:0016192 biological_process vesicle-mediated transport
GO:0030117 cellular_component membrane coat
GO:0005488 molecular_function binding
GO:0005515 molecular_function protein binding

KEGG Analysis

Analysis Date: 01-18-2011 (KEGG analysis for Vaccinium corymbosum unigene v1)
K12400 AP4E1; AP-4 complex subunit epsilon-1

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CF810429_3_ORF1 CRC64: 23FADA6097298AED LENGTH: 205 aa
InterPro
IPR002553
Domain
Clathrin/coatomer adaptor, adaptin-like, N-terminal
PF01602 [5-102]T 3.4e-07 PF01602 Adaptin_N Adaptin_N
InterPro
IPR011989
Domain
Armadillo-like helical
G3DSA:1.25.10.10 [2-134]T 7.2e-16 G3DSA:1.25.10.10 no description no description
InterPro
IPR016024
Domain
Armadillo-type fold
SSF48371 [7-153]T 1.4e-07 SSF48371 ARM repeat ARM repeat
noIPR
unintegrated
unintegrated
PTHR22780 [1-205]T 1.5e-69 PTHR22780 ADAPTIN, ALPHA/GAMMA/EPSILON ADAPTIN, ALPHA/GAMMA/EPSILON
PTHR22780:SF6 [1-205]T 1.5e-69 PTHR22780:SF6 ADAPTER-RELATED PROTEIN COMPLEX 4 EPSILON SUBUNIT (EPSILON SUBUNIT OF AP-4) ADAPTER-RELATED PROTEIN COMPLEX 4 EPSILON SUBUNIT (EPSILON SUBUNIT OF AP-4)

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CF810429
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0004s243401.42e-9380.49%POPTR_0004s24340.2
HSP 1
Score: 338.961 bits (868), Expect = 1.41565e-93
Identity = 165/205 (80.49%), Postives = 186/205 (90.73%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
KLPS FL VICWVLGEYGTADGK+SASY+TGKLCDVAES+SSD+TVKAYAV ALMKIYAFEIAAGRK+D+LPECQSLIEELSASHSTDLQQRAYELQAVI LD RA+ SIMP DASCEDIE+DK LSFLN +VQQSLEKGAQPYIPENERSG++++++ R+QD E ++H LRFEAYELPKP + S PP+SV+ STELVPVPEP
Sbjct: 494 KLPSVFLHVICWVLGEYGTADGKFSASYVTGKLCDVAESYSSDETVKAYAVTALMKIYAFEIAAGRKLDILPECQSLIEELSASHSTDLQQRAYELQAVIGLDVRAIGSIMPSDASCEDIEVDKCLSFLNGYVQQSLEKGAQPYIPENERSGMVNISNFRNQDQLEVASHGLRFEAYELPKPSVQSWTPPMSVASSTELVPVPEP 698

POPTR_0004s243401.42e-9380.49%POPTR_0004s24340.1
HSP 1
Score: 338.961 bits (868), Expect = 1.41565e-93
Identity = 165/205 (80.49%), Postives = 186/205 (90.73%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
KLPS FL VICWVLGEYGTADGK+SASY+TGKLCDVAES+SSD+TVKAYAV ALMKIYAFEIAAGRK+D+LPECQSLIEELSASHSTDLQQRAYELQAVI LD RA+ SIMP DASCEDIE+DK LSFLN +VQQSLEKGAQPYIPENERSG++++++ R+QD E ++H LRFEAYELPKP + S PP+SV+ STELVPVPEP
Sbjct: 494 KLPSVFLHVICWVLGEYGTADGKFSASYVTGKLCDVAESYSSDETVKAYAVTALMKIYAFEIAAGRKLDILPECQSLIEELSASHSTDLQQRAYELQAVIGLDVRAIGSIMPSDASCEDIEVDKCLSFLNGYVQQSLEKGAQPYIPENERSGMVNISNFRNQDQLEVASHGLRFEAYELPKPSVQSWTPPMSVASSTELVPVPEP 698

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CF810429
Best 10 Hits Shown

Match Name E value Identity Description
ppa001563m 1.45e-7669.76%ppa001563m
HSP 1
Score: 281.952 bits (720), Expect = 1.45347e-76
Identity = 143/205 (69.76%), Postives = 162/205 (79.02%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
KLPS FLQVICWVLGEYGTADGKYSASYI GK CDVAE++S+++ VK CQSL++ELSASH+TDLQQRAYELQAVISLDA AVESIMP DASCEDIEIDKSLSFLN +VQQ+LEKGAQPYIPENERSG+L++++ +QD EA TH LRFEAYELPKP +PSR PP +V+ STELVPVPEP
Sbjct: 359 KLPSVFLQVICWVLGEYGTADGKYSASYIIGKSCDVAEAYSNEEPVK--------------------------CQSLVDELSASHATDLQQRAYELQAVISLDAPAVESIMPSDASCEDIEIDKSLSFLNGYVQQALEKGAQPYIPENERSGMLNISNFSNQDQREALTHGLRFEAYELPKPAVPSRIPPAAVASSTELVPVPEP 537

ppa023280m 5.03e-5376.52%ppa023280m
HSP 1
Score: 203.756 bits (517), Expect = 5.03039e-53
Identity = 101/132 (76.52%), Postives = 115/132 (87.12%), Query Frame = 3
Query:  222 CQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
CQSL+EELSASHSTDLQQRAYELQA+ISLD+ AVESIM DAS EDIEIDKSLSFLN +VQQ+LEKGAQPYIPENERSG+L++++ +QD HEA T LRFEAYE PKP +PS PP +V+ STELVPVPEP
Sbjct: 133 CQSLVEELSASHSTDLQQRAYELQAIISLDSPAVESIMLSDASFEDIEIDKSLSFLNGYVQQALEKGAQPYIPENERSGMLNISNFSNQDQHEALTRGLRFEAYEHPKPAVPSGIPPAAVASSTELVPVPEP 264

ppa007347m 1.57e-3875.79%ppa007347m
HSP 1
Score: 155.606 bits (392), Expect = 1.57101e-38
Identity = 72/95 (75.79%), Postives = 83/95 (87.37%), Query Frame = 3
Query:  333 MPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
MP DASCEDIEIDK LSFLN +VQQ+LEKGAQPYIPENERSG+L++++ +QD HEA TH LRFEAYELPKP +PSR PP +V+ STELVPVPEP
Sbjct: 1 MPSDASCEDIEIDKRLSFLNGYVQQALEKGAQPYIPENERSGMLNISNFSTQDQHEALTHGLRFEAYELPKPAVPSRIPPAAVASSTELVPVPEP 95

ppa007356m 5.97e-3875.79%ppa007356m
HSP 1
Score: 153.68 bits (387), Expect = 5.96985e-38
Identity = 72/95 (75.79%), Postives = 83/95 (87.37%), Query Frame = 3
Query:  333 MPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
MP DASCEDIEIDKSLSFLN +VQQ+LEKGAQPYIPENERSG+L++++ +QD HEA TH LRFEAYELPK +PSR PP +V+ STELVPVPEP
Sbjct: 1 MPSDASCEDIEIDKSLSFLNGYVQQALEKGAQPYIPENERSGMLNISNFSNQDQHEALTHGLRFEAYELPKLAVPSRIPPAAVASSTELVPVPEP 95

ppa003225m 1.86e-3184.93%ppa003225m
HSP 1
Score: 132.109 bits (331), Expect = 1.86009e-31
Identity = 62/73 (84.93%), Postives = 70/73 (95.89%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPE 221
KLPS FLQVICWVLGEYGTADGKYSASYITGKLCDVAE++S+D++VKAYAV A+MKIYAFEI+A RKVD+LPE
Sbjct: 494 KLPSVFLQVICWVLGEYGTADGKYSASYITGKLCDVAEAYSNDESVKAYAVTAIMKIYAFEISAQRKVDILPE 566

ppb009195m 2.97e-2980.26%ppb009195m
HSP 1
Score: 124.79 bits (312), Expect = 2.96968e-29
Identity = 61/76 (80.26%), Postives = 69/76 (90.79%), Query Frame = 3
Query:  285 ELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTH 512
ELQAVISLDA AVESIMP DASCEDIEIDKSLSFLN +VQQ+LEKGAQPYIPENERSG+L++++ +QD HEA TH
Sbjct: 71 ELQAVISLDAPAVESIMPSDASCEDIEIDKSLSFLNGYVQQALEKGAQPYIPENERSGMLNISNFSNQDQHEALTH 146

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CF810429
Best 10 Hits Shown

Match Name E value Identity Description
AP4E1_HUMAN2.14e-1732.20%
AP-4 complex subunit epsilon-1 OS=Homo s...
HSP 1
Score: 88.9669 bits (219), Expect = 2.13699e-17
Identity = 57/177 (32.20%), Postives = 91/177 (51.41%), Query Frame = 3
Query:    9 PSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYEL 539
P FLQV+ WVLGEY K + + KL + + S KA+ +AA+ K+ + ++ + LI E + S T ++Q A+EL+ + + ++S++P+D SCED+ +D SLSFL+ FV + L +GA PY P ++R Q+ + L FE Y L
Sbjct: 507 PQRFLQVMSWVLGEYSYLLDKETPEEVIAKLYKLLMNDSVSSETKAWLIAAVTKLTSQAHSSNT-------VERLIHEFTISLDTCMRQHAFELKHLHE-NVELMKSLLPVDRSCEDLVVDASLSFLDGFVAEGLSQGAAPYKPPHQR-----------QEEKLSQEKVLNFEPYGL 664

AP4E1_MOUSE1.53e-1532.77%
AP-4 complex subunit epsilon-1 OS=Mus mu...
HSP 1
Score: 82.8037 bits (203), Expect = 1.53147e-15
Identity = 58/177 (32.77%), Postives = 87/177 (49.15%), Query Frame = 3
Query:    9 PSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYEL 539
P FLQV+ WVLGEY K S + +L + S S KA+ AA+ K+ + P + LI+E + S +T L+Q A+EL+ + + ++S++ +CEDI D SLSFL+ FV + L +GA PY P ++R Q+ + L FE Y L
Sbjct: 506 PQRFLQVMSWVLGEYSYLLDKESPEEVITRLYKLLMSDSISSETKAWLFAAVTKLTP-------QAHSSPLVEKLIQEFTVSLNTCLRQHAFELKHLHE-NTELMKSLLQGAQNCEDIVADASLSFLDGFVAEGLSQGAAPYKPHHQR-----------QEEQLSQEKVLNFEPYGL 663

AP4E_DICDI2.80e-0927.03%
AP-4 complex subunit epsilon OS=Dictyost...
HSP 1
Score: 62.003 bits (149), Expect = 2.79747e-09
Identity = 50/185 (27.03%), Postives = 90/185 (48.65%), Query Frame = 3
Query:   18 FLQVICWVLGEYGT---ADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSG--VLDVASLRSQDHHEASTHSLRFEAYELPKPVIP 557
+++++ WV+ EY ++ S I LCD+ E +T K++ + + K+ A G+ LP + + ++ +S S QQR+ EL ++ + +++ I+PLDA CEDI+ +K N F S + G + YIP +R ++D++ S +E L F+ P P P
Sbjct: 572 YIKIMSWVISEYSNLIVSNNGVIESDIISYLCDLLEKDYQGET-KSWIIIGIGKLVA---QLGKS---LPMLELMTKKFKSSKSLICQQRSSELNEILK-NPKSMSLILPLDAYCEDIDFNK---IFNKFNDYSNKVGGKQYIPYEKRKNTPLVDISDGSSSHSNE---KGLNFQYPPPPDPFNP 742

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CF810429
Best 10 Hits Shown

Match Name E value Identity Description
D7TFC9_VITVI8.89e-9381.46%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 343.199 bits (879), Expect = 8.88661e-93
Identity = 167/205 (81.46%), Postives = 190/205 (92.68%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
KLPSAFLQVICWVLGEYGTA GKYSASYITGKLCDVAE+HSS+DTVKAYAV ALMK+YAFEIAAGRKVD+LPECQSLIEELSASHSTDLQQRAYELQAV++LDA AVE IMP DASCEDIE+DK+LSFL+S+V++SLE+GAQPYIPENERSG++++++ RSQD H+ STH+LRFEAYELPK P R PVS++ STELVPVPEP
Sbjct: 482 KLPSAFLQVICWVLGEYGTAGGKYSASYITGKLCDVAEAHSSNDTVKAYAVTALMKVYAFEIAAGRKVDMLPECQSLIEELSASHSTDLQQRAYELQAVVTLDAHAVEIIMPSDASCEDIEVDKNLSFLDSYVERSLEQGAQPYIPENERSGMINISNFRSQDQHDTSTHTLRFEAYELPKTSAPPRISPVSLAPSTELVPVPEP 686

B9S1S1_RICCO1.16e-9281.46%
AP-1 complex subunit gamma-2, putative O...
HSP 1
Score: 342.813 bits (878), Expect = 1.16063e-92
Identity = 167/205 (81.46%), Postives = 189/205 (92.20%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
KLPS FLQVICWVLGEYGTADGK+SASYITGKLCDVA+++S+D+TVKAYAV ALMK+YAFEIAAGRKVD+LPECQSLIEELSASHSTDLQQRAYELQAVI LDA AVE I+P DASCEDIEID +LSFL+ +VQQS+EKGAQPYIPE+ERSGVL+++S R+QD HEAS+H LRFEAYELPKP PSR PPV+++ S ELVPVPEP
Sbjct: 494 KLPSVFLQVICWVLGEYGTADGKFSASYITGKLCDVADAYSNDETVKAYAVTALMKLYAFEIAAGRKVDILPECQSLIEELSASHSTDLQQRAYELQAVIGLDAHAVECILPSDASCEDIEIDDNLSFLDGYVQQSIEKGAQPYIPESERSGVLNISSFRNQDQHEASSHGLRFEAYELPKPSAPSRIPPVALAPSRELVPVPEP 698

B9N0P6_POPTR1.68e-9180.49%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 338.961 bits (868), Expect = 1.67594e-91
Identity = 165/205 (80.49%), Postives = 186/205 (90.73%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
KLPS FL VICWVLGEYGTADGK+SASY+TGKLCDVAES+SSD+TVKAYAV ALMKIYAFEIAAGRK+D+LPECQSLIEELSASHSTDLQQRAYELQAVI LD RA+ SIMP DASCEDIE+DK LSFLN +VQQSLEKGAQPYIPENERSG++++++ R+QD E ++H LRFEAYELPKP + S PP+SV+ STELVPVPEP
Sbjct: 494 KLPSVFLHVICWVLGEYGTADGKFSASYVTGKLCDVAESYSSDETVKAYAVTALMKIYAFEIAAGRKLDILPECQSLIEELSASHSTDLQQRAYELQAVIGLDVRAIGSIMPSDASCEDIEVDKCLSFLNGYVQQSLEKGAQPYIPENERSGMVNISNFRNQDQLEVASHGLRFEAYELPKPSVQSWTPPMSVASSTELVPVPEP 698

Q9C6W3_ARATH3.38e-8475.12%
Epsilon-adaptin, putative OS=Arabidopsis...
HSP 1
Score: 314.694 bits (805), Expect = 3.38475e-84
Identity = 154/205 (75.12%), Postives = 177/205 (86.34%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
KLPS FLQVI WVLGEYGTADGKYSASYI+GKLCDVA+++SSD+TVK YAV+ALMKIYAFEIA+GRKVD+LPECQSLIEEL ASHSTDLQQRAYELQA+++LDARAVE+I+PLDASCEDIE+DK LSFLN ++QQ++E GAQPYI E ERSG+ + QDHHE TH+LRFEAYELPKP +P +A S ELVPVPEP
Sbjct: 489 KLPSLFLQVISWVLGEYGTADGKYSASYISGKLCDVADAYSSDETVKGYAVSALMKIYAFEIASGRKVDVLPECQSLIEELLASHSTDLQQRAYELQALLALDARAVETILPLDASCEDIEVDKDLSFLNGYIQQAIESGAQPYISERERSGMFETTDYHPQDHHEVPTHALRFEAYELPKPSVPPQA-------SNELVPVPEP 686

Q8L7A9_ARATH3.38e-8475.12%
Putative epsilon-adaptin OS=Arabidopsis ...
HSP 1
Score: 314.694 bits (805), Expect = 3.38475e-84
Identity = 154/205 (75.12%), Postives = 177/205 (86.34%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
KLPS FLQVI WVLGEYGTADGKYSASYI+GKLCDVA+++SSD+TVK YAV+ALMKIYAFEIA+GRKVD+LPECQSLIEEL ASHSTDLQQRAYELQA+++LDARAVE+I+PLDASCEDIE+DK LSFLN ++QQ++E GAQPYI E ERSG+ + QDHHE TH+LRFEAYELPKP +P +A S ELVPVPEP
Sbjct: 494 KLPSLFLQVISWVLGEYGTADGKYSASYISGKLCDVADAYSSDETVKGYAVSALMKIYAFEIASGRKVDVLPECQSLIEELLASHSTDLQQRAYELQALLALDARAVETILPLDASCEDIEVDKDLSFLNGYIQQAIESGAQPYISERERSGMFETTDYHPQDHHEVPTHALRFEAYELPKPSVPPQA-------SNELVPVPEP 691

C5XG75_SORBI3.38e-8473.17%
Putative uncharacterized protein Sb03g04...
HSP 1
Score: 314.694 bits (805), Expect = 3.38475e-84
Identity = 150/205 (73.17%), Postives = 180/205 (87.80%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVS-HSTELVPVPE 614
KLPS+FLQ+ICWVLGEYGTADGKYSASYI GKLCDVAE+H +DDTVKAYA++A++KI+AFEIA GRK+DLLPECQ+L++ELSASHSTDLQQRAYELQA++ LD AVES+MP DASCEDIE+D++LSFLNS+VQQ+LE GA PYIPE+ERSGV+ V S RSQ+ E S H+LRFEAYE+PKP +P S+S +T+LVPVPE
Sbjct: 494 KLPSSFLQIICWVLGEYGTADGKYSASYIIGKLCDVAEAHLTDDTVKAYAISAILKIFAFEIALGRKIDLLPECQTLVDELSASHSTDLQQRAYELQALLGLDKNAVESVMPADASCEDIEVDRNLSFLNSYVQQALENGASPYIPESERSGVISVGSYRSQEQQETSAHTLRFEAYEMPKPSLPLATSQTSISTPTTDLVPVPE 698

D7KGL8_ARALY2.87e-8375.12%
Putative uncharacterized protein OS=Arab...
HSP 1
Score: 311.612 bits (797), Expect = 2.86536e-83
Identity = 154/205 (75.12%), Postives = 176/205 (85.85%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
KLPS FLQVI WVLGEYGTADGKYSASYI+GKLCDVA+++SSD+TVK YAV+ALMKIYAFEIA+GRKVD+LPECQSLIEEL ASHSTDLQQRAYELQA+++LDARAVESI+PLDASCEDIE+DK LSFLN ++QQ++E GAQPYI E ERSG+ + QDHHE +H+LRFEAYELPKP P +A S ELVPVPEP
Sbjct: 494 KLPSLFLQVISWVLGEYGTADGKYSASYISGKLCDVADAYSSDETVKGYAVSALMKIYAFEIASGRKVDVLPECQSLIEELLASHSTDLQQRAYELQALLALDARAVESILPLDASCEDIEVDKDLSFLNGYIQQAIESGAQPYISERERSGMFETTDYHPQDHHEVPSHALRFEAYELPKPSGPPQA-------SNELVPVPEP 691

C0PHF1_MAIZE6.38e-8372.68%
Putative uncharacterized protein OS=Zea ...
HSP 1
Score: 310.457 bits (794), Expect = 6.38336e-83
Identity = 149/205 (72.68%), Postives = 177/205 (86.34%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVS-HSTELVPVPE 614
KLPS+FLQ+ICWVLGEYGTADGKYSASYI GKLCDVAE+H +DDTVKAYA++A++K +AFEI GRK+DLLPECQ+L++ELSASHSTDLQQRAYELQA++ LD AVES+MP DASCEDIE+D+SLSFLNS+VQQ+LE GA PYIPE+ERSGV+ V S RSQ+ E S H+LRFEAYE+PKP +P S+S T+LVPVPE
Sbjct: 494 KLPSSFLQIICWVLGEYGTADGKYSASYIIGKLCDVAEAHLTDDTVKAYAISAILKTFAFEITLGRKIDLLPECQTLVDELSASHSTDLQQRAYELQALLGLDKTAVESVMPADASCEDIEVDRSLSFLNSYVQQALENGASPYIPESERSGVISVGSYRSQEQQETSAHTLRFEAYEMPKPSLPLATSQTSMSTPPTDLVPVPE 698

Q8RZX0_ORYSJ2.97e-8070.73%
Os01g0916200 protein OS=Oryza sativa sub...
HSP 1
Score: 301.597 bits (771), Expect = 2.96519e-80
Identity = 145/205 (70.73%), Postives = 177/205 (86.34%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
KLPS+FLQ+ICWVLGEYGTADGKYSASYI GKL DVAE+H +DDTV+AYA++A++KI+AFEIA GRK+D+LPECQSLI+ELSASHSTDLQQRAYELQA++ LD +AVE++MP DASCEDIEID++LSFLN +VQQ++E GA PYIPE+ERSGV+ V + ++QD E S H+LRFEAYEL P A S+S +T+LVPVPEP
Sbjct: 494 KLPSSFLQIICWVLGEYGTADGKYSASYIIGKLYDVAEAHPTDDTVRAYAISAILKIFAFEIALGRKIDMLPECQSLIDELSASHSTDLQQRAYELQALLGLDKQAVENVMPADASCEDIEIDRNLSFLNGYVQQAIENGAAPYIPESERSGVVSVGNYKAQDQQETSAHALRFEAYEL-----PPAASQASISPTTDLVPVPEP 693

A3A0W6_ORYSJ2.97e-8070.73%
Putative uncharacterized protein OS=Oryz...
HSP 1
Score: 301.597 bits (771), Expect = 2.96519e-80
Identity = 145/205 (70.73%), Postives = 177/205 (86.34%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
KLPS+FLQ+ICWVLGEYGTADGKYSASYI GKL DVAE+H +DDTV+AYA++A++KI+AFEIA GRK+D+LPECQSLI+ELSASHSTDLQQRAYELQA++ LD +AVE++MP DASCEDIEID++LSFLN +VQQ++E GA PYIPE+ERSGV+ V + ++QD E S H+LRFEAYEL P A S+S +T+LVPVPEP
Sbjct: 429 KLPSSFLQIICWVLGEYGTADGKYSASYIIGKLYDVAEAHPTDDTVRAYAISAILKIFAFEIALGRKIDMLPECQSLIDELSASHSTDLQQRAYELQALLGLDKQAVENVMPADASCEDIEIDRNLSFLNGYVQQAIENGAAPYIPESERSGVVSVGNYKAQDQQETSAHALRFEAYEL-----PPAASQASISPTTDLVPVPEP 628

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CF810429
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010368870014.54e-9581.46%GSVIVT01036887001 assembled CDS
HSP 1
Score: 343.199 bits (879), Expect = 4.54476e-95
Identity = 167/205 (81.46%), Postives = 190/205 (92.68%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
KLPSAFLQVICWVLGEYGTA GKYSASYITGKLCDVAE+HSS+DTVKAYAV ALMK+YAFEIAAGRKVD+LPECQSLIEELSASHSTDLQQRAYELQAV++LDA AVE IMP DASCEDIE+DK+LSFL+S+V++SLE+GAQPYIPENERSG++++++ RSQD H+ STH+LRFEAYELPK P R PVS++ STELVPVPEP
Sbjct: 482 KLPSAFLQVICWVLGEYGTAGGKYSASYITGKLCDVAEAHSSNDTVKAYAVTALMKVYAFEIAAGRKVDMLPECQSLIEELSASHSTDLQQRAYELQAVVTLDAHAVEIIMPSDASCEDIEVDKNLSFLDSYVERSLEQGAQPYIPENERSGMINISNFRSQDQHDTSTHTLRFEAYELPKTSAPPRISPVSLAPSTELVPVPEP 686

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CF810429
Best 10 Hits Shown

Match Name E value Identity Description
AT1G31730.1 2.49e-8675.12%
Adaptin family protein | chr1:11359907-...
HSP 1
Score: 314.694 bits (805), Expect = 2.48685e-86
Identity = 154/205 (75.12%), Postives = 177/205 (86.34%), Query Frame = 3
Query:    3 KLPSAFLQVICWVLGEYGTADGKYSASYITGKLCDVAESHSSDDTVKAYAVAALMKIYAFEIAAGRKVDLLPECQSLIEELSASHSTDLQQRAYELQAVISLDARAVESIMPLDASCEDIEIDKSLSFLNSFVQQSLEKGAQPYIPENERSGVLDVASLRSQDHHEASTHSLRFEAYELPKPVIPSRAPPVSVSHSTELVPVPEP 617
KLPS FLQVI WVLGEYGTADGKYSASYI+GKLCDVA+++SSD+TVK YAV+ALMKIYAFEIA+GRKVD+LPECQSLIEEL ASHSTDLQQRAYELQA+++LDARAVE+I+PLDASCEDIE+DK LSFLN ++QQ++E GAQPYI E ERSG+ + QDHHE TH+LRFEAYELPKP +P +A S ELVPVPEP
Sbjct: 494 KLPSLFLQVISWVLGEYGTADGKYSASYISGKLCDVADAYSSDETVKGYAVSALMKIYAFEIASGRKVDVLPECQSLIEELLASHSTDLQQRAYELQALLALDARAVETILPLDASCEDIEVDKDLSFLNGYIQQAIESGAQPYISERERSGMFETTDYHPQDHHEVPTHALRFEAYELPKPSVPPQA-------SNELVPVPEP 691

Related info for CF810429