CF811079

Information for CF811079

NameCF811079
AccessionID2237
Length642 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014530 cDNA cold acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CF811079
Sequence
GCCACAATAAGTTGTAACCAGTTGATACAAAATCACTTTACAAACAGCTAAAAAGAACGA
CGAAACATTACACAGCCAATAGCTCTCTCCTATAAGGTGTCCCCAGCACTTCGCAGGCTT
GGATCCAAACAAAAATAAATCCAAAAGCCTTCAACTCAACTGGGGATCAAATACATACAT
TTGACATACAGATCCTAAGTAGCACTAACATTTTGTACAGGTCACAGCGATAAACACCAA
AGATATCTGTAAAATAGAAAATGGAAAGACAACGATGCCACCAGTGGAGTCCTCTCCCGA
CTATCTTCCTGATGTGACCAAATTTTTACCCTCTTGAGCTGCAATTGAACCAGTTGCCAA
TGAAAGAGGAAGAGGAAGAGGAAGTGGAGGCTCTCCCTTTGAACGAGAAGGCGACATTTG
AAGTGGTGATGTTTCTGCAAGGAGGATTTCTTCCTGGGCAGTCTGTGGCATTGGTTCCTT
AGGCTTTGGTGTGAAATCGAAGGAGAGATCTTTGTTGGAGGCAAGCGCTAGCAGTTCTTT
CTCCTCTAGCCCTTTCGGTGCTTCCAGGCTGCAACGATCTGTGTTGTGCTTTGCCAATGC
ATCTCTGAATTTCTTGATCGTGGCATTAGTGCAGCTAAAGNR
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0045454 biological_process cell redox homeostasis
GO:0006662 biological_process glycerol ether metabolic process
GO:0009055 molecular_function electron carrier activity
GO:0015035 molecular_function protein disulfide oxidoreductase activity

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CF811079_2_ORF2 CRC64: 6612C703497EEDB4 LENGTH: 73 aa
noIPR
unintegrated
unintegrated
seg [26-50]? NA seg seg seg
SEQUENCE: CF811079_3_ORF2 CRC64: 22235D12D08708CE LENGTH: 54 aa
noIPR
unintegrated
unintegrated
seg [17-24]? NA seg seg seg
SEQUENCE: CF811079_4_ORF1 CRC64: C2EB8FEC79AB82CF LENGTH: 112 aa
InterPro
IPR005746
Family
Thioredoxin
PTHR10438 [1-37]T 8.3e-14 PTHR10438 THIOREDOXIN-RELATED THIOREDOXIN-RELATED
noIPR
unintegrated
unintegrated
PTHR10438:SF7 [1-37]T 8.3e-14 PTHR10438:SF7 THIOREDOXIN-LIKE THIOREDOXIN-LIKE
seg [25-40]? NA seg seg[84-94]? NA seg seg seg
SEQUENCE: CF811079_5_ORF2 CRC64: F97AAB70BC6F1549 LENGTH: 50 aa
noIPR
unintegrated
unintegrated
seg [31-38]? NA seg seg seg
SEQUENCE: CF811079_6_ORF2 CRC64: 5ED02DF8936A2E09 LENGTH: 101 aa
noIPR
unintegrated
unintegrated
seg [47-64]? NA seg seg seg

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CF811079
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0019s047501.40e-1445.61%POPTR_0019s04750.1
HSP 1
Score: 76.6406 bits (187), Expect = 1.40157e-14
Identity = 52/114 (45.61%), Postives = 62/114 (54.39%), Query Frame = -1
Query:  304 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPKEPMPQTAQEEILLAETSPLQMSPSRSKGEXXXXXXXXXXLATGSIAAQ--EGKNLVTSGR 639
FSCTNATIKKF+DALAKH +RCS A+NKDLSF +TPKP +P P A+EE+ A T+ PS S T S +AQ E K LV+SGR
Sbjct: 193 FSCTNATIKKFKDALAKHTPERCSLGPTKGLEEKELVALAANKDLSFTYTPKPVQPAPVPAEEEV--APTA----GPSHS-----DRGLPLPLPITSSKSAQDSEEKTLVSSGR 295

POPTR_0013s057902.64e-1342.11%POPTR_0013s05790.1
HSP 1
Score: 72.4034 bits (176), Expect = 2.64325e-13
Identity = 48/114 (42.11%), Postives = 56/114 (49.12%), Query Frame = -1
Query:  304 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPKEPMPQTAQEEILLAETSPLQMSPSRSKGEXXXXXXXXXXLATGSIAAQ--EGKNLVTSGR 639
FSCTNATIKKF+DALAKH DRCS A+NKDLSF +TPK +P P EE ++ T + S S G T +AQ E K L SGR
Sbjct: 196 FSCTNATIKKFKDALAKHTPDRCSLGPTKGLEEKELAALAANKDLSFTYTPKKVQPAPVPVAEEEVVPAT-----AASHSDGGLPPLPLTLHLPITSLKSAQDSEEKTLAISGR 304

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CF811079
Best 10 Hits Shown

Match Name E value Identity Description
ppa009412m 5.81e-1550.00%ppa009412m
HSP 1
Score: 77.411 bits (189), Expect = 5.81019e-15
Identity = 38/76 (50.00%), Postives = 52/76 (68.42%), Query Frame = -1
Query:  412 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPKEPMPQTAQEEILLAETSPLQMS 639
FSCTNATIKKFRDALAKH DRCS A+NKD+SF++TPKP E +P T +E++++E +P +++
Sbjct: 198 FSCTNATIKKFRDALAKHKPDRCSLGPTKGLEEKELLALAANKDISFNYTPKPVEAVP-TPAKEVIVSEAAPSRLN 272

ppa009372m 5.81e-1550.00%ppa009372m
HSP 1
Score: 77.411 bits (189), Expect = 5.81019e-15
Identity = 38/76 (50.00%), Postives = 52/76 (68.42%), Query Frame = -1
Query:  412 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPKEPMPQTAQEEILLAETSPLQMS 639
FSCTNATIKKFRDALAKH DRCS A+NKD+SF++TPKP E +P T +E++++E +P +++
Sbjct: 199 FSCTNATIKKFRDALAKHKPDRCSLGPTKGLEEKELLALAANKDISFNYTPKPVEAVP-TPAKEVIVSEAAPSRLN 273

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CF811079
Best 10 Hits Shown

Match Name E value Identity Description
TRL11_ARATH1.05e-0958.49%
Thioredoxin-like 1-1, chloroplastic OS=A...
HSP 1
Score: 63.5438 bits (153), Expect = 1.05452e-09
Identity = 31/53 (58.49%), Postives = 35/53 (66.04%), Query Frame = -1
Query:  481 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKP 639
FSCTNATIKKFRDALAKH DRCS A+NK+L+F +TPKP
Sbjct: 187 FSCTNATIKKFRDALAKHGPDRCSLGPTKGLEEKELVALAANKELNFTYTPKP 239

TRL12_ORYSJ1.80e-0957.41%
Thioredoxin-like 1-2, chloroplastic OS=O...
HSP 1
Score: 62.7734 bits (151), Expect = 1.79875e-09
Identity = 31/54 (57.41%), Postives = 35/54 (64.81%), Query Frame = -1
Query:  478 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPK 639
FSCTNATIKKFRDALAKH DRCS A+NKDL F++T KP+
Sbjct: 184 FSCTNATIKKFRDALAKHKPDRCSLGPTRGLEESELLALAANKDLQFNYTKKPE 237

TRL13_ARATH2.20e-0740.00%
Thioredoxin-like 1-3, chloroplastic OS=A...
HSP 1
Score: 55.8398 bits (133), Expect = 2.19882e-07
Identity = 28/70 (40.00%), Postives = 41/70 (58.57%), Query Frame = -1
Query:  430 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPKEPMPQTAQEEILLAET 639
FSCTNATI+KF++AL KH ++CS A+NKDLSFD+ P + + ++EI L ++
Sbjct: 183 FSCTNATIRKFKEALEKHGREQCSIGETKGLEEKELVAMAANKDLSFDYKPTSCGNIQEQKKKEIFLPKS 252

TRL11_ORYSJ2.87e-0752.94%
Thioredoxin-like 1-1, chloroplastic OS=O...
HSP 1
Score: 55.4546 bits (132), Expect = 2.87174e-07
Identity = 27/51 (52.94%), Postives = 31/51 (60.78%), Query Frame = -1
Query:  487 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTP 639
FSCTNATIKKF+DALAKH DRC A N+DL+F +TP
Sbjct: 183 FSCTNATIKKFKDALAKHGPDRCGLGPAKGLEESELMALAINRDLNFTYTP 233

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CF811079
Best 10 Hits Shown

Match Name E value Identity Description
B9IPM3_POPTR1.74e-1245.61%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 76.6406 bits (187), Expect = 1.74008e-12
Identity = 52/114 (45.61%), Postives = 62/114 (54.39%), Query Frame = -1
Query:  304 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPKEPMPQTAQEEILLAETSPLQMSPSRSKGEXXXXXXXXXXLATGSIAAQ--EGKNLVTSGR 639
FSCTNATIKKF+DALAKH +RCS A+NKDLSF +TPKP +P P A+EE+ A T+ PS S T S +AQ E K LV+SGR
Sbjct: 193 FSCTNATIKKFKDALAKHTPERCSLGPTKGLEEKELVALAANKDLSFTYTPKPVQPAPVPAEEEV--APTA----GPSHS-----DRGLPLPLPITSSKSAQDSEEKTLVSSGR 295

B9SHJ2_RICCO3.88e-1243.86%
Thioredoxin, putative OS=Ricinus communi...
HSP 1
Score: 75.485 bits (184), Expect = 3.87649e-12
Identity = 50/114 (43.86%), Postives = 61/114 (53.51%), Query Frame = -1
Query:  304 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPKEPMPQTAQEEILLAETSPLQMSPSRSKGEXXXXXXXXXXLATGSIAAQE--GKNLVTSGR 639
FSCTNATIKKF+DALAKH DRCS ASNKDL+F TPKP +P AQEEI+ A +P ++ + T ++AQ+ K LVTSGR
Sbjct: 192 FSCTNATIKKFKDALAKHTPDRCSLGPTKGLEEKELIALASNKDLNFTCTPKPVQP-TAPAQEEIIPAALTPAHVNQT--------LPLPIPLSTTSLMSAQDLGEKTLVTSGR 296

A2Q5R3_MEDTR2.51e-1145.68%
Thioredoxin domain 2; Thioredoxin fold O...
HSP 1
Score: 72.7886 bits (177), Expect = 2.51266e-11
Identity = 37/81 (45.68%), Postives = 44/81 (54.32%), Query Frame = -1
Query:  397 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPKEPMPQTAQEEILLAETSPLQMSPSRSK 639
FSCTNATIKKFRDALAKH DRCS + N+DL+F +TPKP +P+ A EE+ L SK
Sbjct: 197 FSCTNATIKKFRDALAKHTPDRCSLEPTKGLEEKELIALSENRDLNFTYTPKPSQPVHTPANEEVATEAVPSLTSKSEVSK 277

A9PI73_POPTR3.28e-1142.11%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 72.4034 bits (176), Expect = 3.28164e-11
Identity = 48/114 (42.11%), Postives = 56/114 (49.12%), Query Frame = -1
Query:  304 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPKEPMPQTAQEEILLAETSPLQMSPSRSKGEXXXXXXXXXXLATGSIAAQ--EGKNLVTSGR 639
FSCTNATIKKF+DALAKH DRCS A+NKDLSF +TPK +P P EE ++ T + S S G T +AQ E K L SGR
Sbjct: 196 FSCTNATIKKFKDALAKHTPDRCSLGPTKGLEEKELAALAANKDLSFTYTPKKVQPAPVPVAEEEVVPAT-----AASHSDGGLPPLPLTLPLPITSLKSAQDSEEKTLAISGR 304

D7TI43_VITVI5.60e-1150.00%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 71.633 bits (174), Expect = 5.59763e-11
Identity = 38/76 (50.00%), Postives = 46/76 (60.53%), Query Frame = -1
Query:  412 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPKEPMPQTAQEEILLAETSPLQMS 639
FSCTNATIKKF+DALAKH DRCS ++NKD SF+++PK P+P AQEEI + TS S
Sbjct: 200 FSCTNATIKKFKDALAKHTPDRCSLEPTKGLEEKELLALSANKDFSFNYSPK---PVPTPAQEEIAVEATSAAAFS 272

A5AQX7_VITVI7.31e-1152.11%
Putative uncharacterized protein OS=Viti...
HSP 1
Score: 71.2478 bits (173), Expect = 7.31074e-11
Identity = 37/71 (52.11%), Postives = 45/71 (63.38%), Query Frame = -1
Query:  427 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPKEPMPQTAQEEILLAETS 639
FSCTNATIKKF+DALAKH DRCS ++NKD SF+++PK P+P AQEEI + TS
Sbjct: 202 FSCTNATIKKFKDALAKHTPDRCSLEPTKGLEEKELLALSANKDFSFNYSPK---PVPTPAQEEIAVEATS 269

Q40230_LILLO3.63e-1058.33%
Thioredoxin OS=Lilium longiflorum PE=2 S...
HSP 1
Score: 68.9366 bits (167), Expect = 3.62828e-10
Identity = 35/60 (58.33%), Postives = 41/60 (68.33%), Query Frame = -1
Query:  463 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPK-EPMPQ 639
FSCTNATIKKFRDALAKHNTDRCS A+N++L F +TPKP+ EP+ Q
Sbjct: 173 FSCTNATIKKFRDALAKHNTDRCSLGPTKGLEEKELVALAANRELGFSYTPKPEHEPVHQ 232

D7L1K4_ARALY5.24e-0960.38%
Predicted protein OS=Arabidopsis lyrata ...
HSP 1
Score: 65.0846 bits (157), Expect = 5.23923e-09
Identity = 32/53 (60.38%), Postives = 35/53 (66.04%), Query Frame = -1
Query:  481 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKP 639
FSCTNATIKKFRDALAKH DRCS A+NKDL+F +TPKP
Sbjct: 37 FSCTNATIKKFRDALAKHGPDRCSLGRTKGLEEKELVALAANKDLNFTYTPKP 89

D7KIT3_ARALY1.52e-0858.49%
Thioredoxin family protein OS=Arabidopsi...
HSP 1
Score: 63.5438 bits (153), Expect = 1.52438e-08
Identity = 31/53 (58.49%), Postives = 35/53 (66.04%), Query Frame = -1
Query:  481 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKP 639
FSCTNATIKKFRDALAKH DRCS A+NK+L+F +TPKP
Sbjct: 188 FSCTNATIKKFRDALAKHGPDRCSLGPTKGLEEKELVALAANKELNFTYTPKP 240

A8MQQ7_ARATH1.52e-0858.49%
Uncharacterized protein At1g08570.2 OS=A...
HSP 1
Score: 63.5438 bits (153), Expect = 1.52438e-08
Identity = 31/53 (58.49%), Postives = 35/53 (66.04%), Query Frame = -1
Query:  481 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKP 639
FSCTNATIKKFRDALAKH DRCS A+NK+L+F +TPKP
Sbjct: 156 FSCTNATIKKFRDALAKHGPDRCSLGPTKGLEEKELVALAANKELNFTYTPKP 208

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CF811079
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010333760012.76e-1350.00%GSVIVT01033376001 assembled CDS
HSP 1
Score: 71.633 bits (174), Expect = 2.7574e-13
Identity = 38/76 (50.00%), Postives = 46/76 (60.53%), Query Frame = -1
Query:  412 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPKEPMPQTAQEEILLAETSPLQMS 639
FSCTNATIKKF+DALAKH DRCS ++NKD SF+++PK P+P AQEEI + TS S
Sbjct: 200 FSCTNATIKKFKDALAKHTPDRCSLEPTKGLEEKELLALSANKDFSFNYSPK---PVPTPAQEEIAVEATSAAAFS 272

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CF811079
Best 10 Hits Shown

Match Name E value Identity Description
AT1G08570.4 1.08e-1058.49%
atypical CYS HIS rich thioredoxin 4 | ...
HSP 1
Score: 63.5438 bits (153), Expect = 1.081e-10
Identity = 31/53 (58.49%), Postives = 35/53 (66.04%), Query Frame = -1
Query:  481 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKP 639
FSCTNATIKKFRDALAKH DRCS A+NK+L+F +TPKP
Sbjct: 89 FSCTNATIKKFRDALAKHGPDRCSLGPTKGLEEKELVALAANKELNFTYTPKP 141

AT1G08570.3 1.08e-1058.49%
atypical CYS HIS rich thioredoxin 4 | ...
HSP 1
Score: 63.5438 bits (153), Expect = 1.081e-10
Identity = 31/53 (58.49%), Postives = 35/53 (66.04%), Query Frame = -1
Query:  481 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKP 639
FSCTNATIKKFRDALAKH DRCS A+NK+L+F +TPKP
Sbjct: 89 FSCTNATIKKFRDALAKHGPDRCSLGPTKGLEEKELVALAANKELNFTYTPKP 141

AT1G08570.2 1.08e-1058.49%
atypical CYS HIS rich thioredoxin 4 | ...
HSP 1
Score: 63.5438 bits (153), Expect = 1.081e-10
Identity = 31/53 (58.49%), Postives = 35/53 (66.04%), Query Frame = -1
Query:  481 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKP 639
FSCTNATIKKFRDALAKH DRCS A+NK+L+F +TPKP
Sbjct: 156 FSCTNATIKKFRDALAKHGPDRCSLGPTKGLEEKELVALAANKELNFTYTPKP 208

AT1G08570.1 1.08e-1058.49%
atypical CYS HIS rich thioredoxin 4 | ...
HSP 1
Score: 63.5438 bits (153), Expect = 1.081e-10
Identity = 31/53 (58.49%), Postives = 35/53 (66.04%), Query Frame = -1
Query:  481 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKP 639
FSCTNATIKKFRDALAKH DRCS A+NK+L+F +TPKP
Sbjct: 187 FSCTNATIKKFRDALAKHGPDRCSLGPTKGLEEKELVALAANKELNFTYTPKP 239

AT2G33270.1 2.25e-0840.00%
atypical CYS HIS rich thioredoxin 3 | ...
HSP 1
Score: 55.8398 bits (133), Expect = 2.25403e-08
Identity = 28/70 (40.00%), Postives = 41/70 (58.57%), Query Frame = -1
Query:  430 FSCTNATIKKFRDALAKHNTDRCSXXXXXXXXXXXXXXXASNKDLSFDFTPKPKEPMPQTAQEEILLAET 639
FSCTNATI+KF++AL KH ++CS A+NKDLSFD+ P + + ++EI L ++
Sbjct: 183 FSCTNATIRKFKEALEKHGREQCSIGETKGLEEKELVAMAANKDLSFDYKPTSCGNIQEQKKKEIFLPKS 252

Related info for CF811079