CF811398

Information for CF811398

NameCF811398
AccessionID2259
Length162 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014531 cDNA non acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CF811398
Sequence
ATCACTTCAAGGGGAAGCGTACATATGTTCCCATCACTCAAAAGGGTTACTGGCAGTTTG
AAATGGATGATTTTATGATCGGAAACCATTCAACAGGTTATTGCGATGGTGGATGTGCTG
CTATTGTGGATTCTGGAACATCCTTGCTGGATGGNNCAATTA
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0006508 biological_process proteolysis
GO:0004190 molecular_function aspartic-type endopeptidase activity

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CF811398_3_ORF1 CRC64: ACD07A8FF360A4CA LENGTH: 53 aa
InterPro
IPR001461
Family
Peptidase A1
PTHR13683 [1-51]T 5.9e-27 PTHR13683 ASPARTYL PROTEASES ASPARTYL PROTEASES
PF00026 [1-50]T 9.6e-14 PF00026 Asp Asp
InterPro
IPR009007
Domain
Peptidase aspartic, catalytic
G3DSA:2.40.70.10 [1-51]T 1.6e-17 G3DSA:2.40.70.10 no description no description
InterPro
IPR021109
Domain
Peptidase aspartic
SSF50630 [1-49]T 1.3e-10 SSF50630 Acid proteases Acid proteases
noIPR
unintegrated
unintegrated
PTHR13683:SF85 [1-51]T 5.9e-27 PTHR13683:SF85 ASPARTIC PROTEINASE-RELATED ASPARTIC PROTEINASE-RELATED

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CF811398
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0013s003801.10e-2080.39%POPTR_0013s00380.1
HSP 1
Score: 95.1301 bits (235), Expect = 1.10368e-20
Identity = 41/51 (80.39%), Postives = 44/51 (86.27%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKGK TYVP+TQKGYWQ M DF+IG HSTG C+GGCAAIVDSGTSLL G
Sbjct: 246 HFKGKHTYVPVTQKGYWQINMGDFLIGKHSTGLCEGGCAAIVDSGTSLLAG 296

POPTR_0005s004605.48e-2078.43%POPTR_0005s00460.1
HSP 1
Score: 92.8189 bits (229), Expect = 5.47751e-20
Identity = 40/51 (78.43%), Postives = 44/51 (86.27%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKGK TYVP+T+KGYWQ M DF+IGNHSTG C+ GCAAIVDSGTSLL G
Sbjct: 166 HFKGKHTYVPVTKKGYWQINMGDFLIGNHSTGLCEEGCAAIVDSGTSLLAG 216

POPTR_0021s002902.72e-1974.51%POPTR_0021s00290.1
HSP 1
Score: 90.5077 bits (223), Expect = 2.71846e-19
Identity = 38/51 (74.51%), Postives = 44/51 (86.27%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
H+KGK TYVP+TQKGYWQF+M D ++G+ STGYC GGCAAI DSGTSLL G
Sbjct: 251 HYKGKHTYVPVTQKGYWQFDMGDVIVGDKSTGYCAGGCAAIADSGTSLLAG 301

POPTR_0001s367004.34e-1766.67%POPTR_0001s36700.1
HSP 1
Score: 83.1889 bits (204), Expect = 4.34009e-17
Identity = 34/51 (66.67%), Postives = 42/51 (82.35%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
H+KG+ TYVP+TQKGYWQF+M D +IG ++G+C GCAAI DSGTSLL G
Sbjct: 254 HYKGEHTYVPVTQKGYWQFDMGDVLIGGQTSGFCASGCAAIADSGTSLLAG 304

POPTR_0002s213409.67e-1766.67%POPTR_0002s21340.1
HSP 1
Score: 82.0333 bits (201), Expect = 9.66872e-17
Identity = 34/51 (66.67%), Postives = 40/51 (78.43%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
H+KG+ TYVP+T KGYWQF+M D +IG +TG C GGC AI DSGTSLL G
Sbjct: 253 HYKGEHTYVPVTHKGYWQFDMGDLLIGTETTGLCAGGCKAIADSGTSLLAG 303

POPTR_0004s009001.26e-1668.63%POPTR_0004s00900.1
HSP 1
Score: 81.6481 bits (200), Expect = 1.26277e-16
Identity = 35/51 (68.63%), Postives = 40/51 (78.43%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
H+KGK T+VP+T+KGYWQF M D IG+ TGYC GCAAI DSGTSLL G
Sbjct: 291 HYKGKHTFVPVTRKGYWQFNMGDVHIGDKPTGYCASGCAAIADSGTSLLAG 341

POPTR_0010s006008.19e-1664.71%POPTR_0010s00600.1
HSP 1
Score: 78.9518 bits (193), Expect = 8.18506e-16
Identity = 33/51 (64.71%), Postives = 39/51 (76.47%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKG TYVP+T +GYWQ ++ D I N+STG C GGC+AIVDSGTS L G
Sbjct: 237 HFKGDHTYVPVTGRGYWQIQVGDIFIANNSTGLCAGGCSAIVDSGTSFLSG 287

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CF811398
Best 10 Hits Shown

Match Name E value Identity Description
ppa004505m 6.33e-2076.47%ppa004505m
HSP 1
Score: 92.0485 bits (227), Expect = 6.33158e-20
Identity = 39/51 (76.47%), Postives = 45/51 (88.24%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
H+KGK TYVP+T+KGYWQFEM D +IGN STG C+GGCAA+VDSGTSLL G
Sbjct: 245 HYKGKHTYVPVTRKGYWQFEMGDIVIGNLSTGVCEGGCAAVVDSGTSLLTG 295

ppa003924m 2.66e-1870.59%ppa003924m
HSP 1
Score: 86.6557 bits (213), Expect = 2.66014e-18
Identity = 36/51 (70.59%), Postives = 41/51 (80.39%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKGK TYVP+T+KGYWQF+M D +IG TGYC GGC A+ DSGTSLL G
Sbjct: 278 HFKGKHTYVPVTKKGYWQFDMGDVLIGGKPTGYCSGGCFAVADSGTSLLAG 328

ppa004375m 2.25e-1768.63%ppa004375m
HSP 1
Score: 83.5741 bits (205), Expect = 2.25195e-17
Identity = 35/51 (68.63%), Postives = 42/51 (82.35%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
H+KG+ TYVP+TQKGYWQF+M D MI +TG+C GGC+AI DSGTSLL G
Sbjct: 253 HYKGEHTYVPVTQKGYWQFDMGDVMIDGKTTGFCAGGCSAIADSGTSLLVG 303

ppa004349m 6.55e-1764.71%ppa004349m
HSP 1
Score: 82.0333 bits (201), Expect = 6.55216e-17
Identity = 33/51 (64.71%), Postives = 42/51 (82.35%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
H+KG+ TYVP+TQKGYWQF+M D +IG ++G+C GC+AI DSGTSLL G
Sbjct: 254 HYKGEHTYVPVTQKGYWQFDMGDVLIGGETSGFCASGCSAIADSGTSLLAG 304

ppa004486m 3.60e-1562.75%ppa004486m
HSP 1
Score: 76.2554 bits (186), Expect = 3.59529e-15
Identity = 32/51 (62.75%), Postives = 40/51 (78.43%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HF G TYVPI++KGYWQ ++ D ++ ++STG C GGCAAIVDSGTS L G
Sbjct: 249 HFTGDHTYVPISKKGYWQIDVGDVIVADNSTGLCKGGCAAIVDSGTSFLAG 299

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CF811398
Best 10 Hits Shown

Match Name E value Identity Description
CYPR1_CYNCA3.20e-1772.55%
Cyprosin (Fragment) OS=Cynara cardunculu...
HSP 1
Score: 87.0409 bits (214), Expect = 3.19925e-17
Identity = 37/51 (72.55%), Postives = 43/51 (84.31%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKG+ TYVP+TQKGYWQFEM D +IG+ +TG+C GCAAI DSGTSLL G
Sbjct: 214 HFKGEHTYVPVTQKGYWQFEMGDVLIGDKTTGFCASGCAAIADSGTSLLAG 264

ASPR_CUCPE7.13e-1768.63%
Aspartic proteinase OS=Cucurbita pepo PE...
HSP 1
Score: 85.8853 bits (211), Expect = 7.12719e-17
Identity = 35/51 (68.63%), Postives = 42/51 (82.35%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
H++GK TYVP+TQKGYWQF+M D +I TG+CDGGC+AI DSGTSLL G
Sbjct: 252 HYRGKHTYVPVTQKGYWQFDMGDVLIDGEPTGFCDGGCSAIADSGTSLLAG 302

ASPR_HORVU1.59e-1668.63%Phytepsin OS=Hordeum vulgare PE=1 SV=1
HSP 1
Score: 84.7297 bits (208), Expect = 1.58777e-16
Identity = 35/51 (68.63%), Postives = 42/51 (82.35%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
H+ G+ TYVP+TQKGYWQF+M D ++G STG+C GGCAAI DSGTSLL G
Sbjct: 247 HYVGEHTYVPVTQKGYWQFDMGDVLVGGKSTGFCAGGCAAIADSGTSLLAG 297

CARDB_CYNCA6.03e-1666.67%
Procardosin-B OS=Cynara cardunculus GN=c...
HSP 1
Score: 82.8037 bits (203), Expect = 6.03353e-16
Identity = 34/51 (66.67%), Postives = 41/51 (80.39%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HF+G TYVP+T+KGYWQFEM D +IG+ S+G+C GGCAAI DSGTS G
Sbjct: 248 HFRGNHTYVPVTRKGYWQFEMGDVLIGDKSSGFCAGGCAAIADSGTSFFAG 298

ASPRX_ORYSJ6.03e-1668.63%
Aspartic proteinase OS=Oryza sativa subs...
HSP 1
Score: 82.8037 bits (203), Expect = 6.03353e-16
Identity = 35/51 (68.63%), Postives = 41/51 (80.39%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
H+KG TYVP+++KGYWQF M D +I HSTG+C GCAAIVDSGTSLL G
Sbjct: 240 HYKGDHTYVPVSRKGYWQFNMGDLLIDGHSTGFCAKGCAAIVDSGTSLLAG 290

ASPR1_ORYSJ7.88e-1666.67%
Aspartic proteinase oryzasin-1 OS=Oryza ...
HSP 1
Score: 82.4185 bits (202), Expect = 7.88003e-16
Identity = 34/51 (66.67%), Postives = 41/51 (80.39%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
H+KG TYVP++QKGYWQFEM D +IG +TG+C GC+AI DSGTSLL G
Sbjct: 248 HYKGNHTYVPVSQKGYWQFEMGDVLIGGKTTGFCASGCSAIADSGTSLLAG 298

CARDH_CYNCA1.82e-1258.82%
Cardosin-H (Fragments) OS=Cynara cardunc...
HSP 1
Score: 71.2478 bits (173), Expect = 1.81664e-12
Identity = 30/51 (58.82%), Postives = 37/51 (72.55%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HF+G TYVP+T + YWQF + D +IG+ STG+C GC A DSGTSLL G
Sbjct: 134 HFRGDHTYVPVTYQYYWQFGIGDVLIGDKSTGFCAPGCQAFADSGTSLLSG 184

CARDG_CYNCA1.82e-1258.82%
Cardosin-G (Fragments) OS=Cynara cardunc...
HSP 1
Score: 71.2478 bits (173), Expect = 1.81664e-12
Identity = 30/51 (58.82%), Postives = 37/51 (72.55%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HF+G TYVP+T + YWQF + D +IG+ STG+C GC A DSGTSLL G
Sbjct: 134 HFRGDHTYVPVTYQYYWQFGIGDVLIGDKSTGFCAPGCQAFADSGTSLLSG 184

CARDF_CYNCA1.82e-1258.82%
Cardosin-F (Fragments) OS=Cynara cardunc...
HSP 1
Score: 71.2478 bits (173), Expect = 1.81664e-12
Identity = 30/51 (58.82%), Postives = 37/51 (72.55%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HF+G TYVP+T + YWQF + D +IG+ STG+C GC A DSGTSLL G
Sbjct: 148 HFRGDHTYVPVTYQYYWQFGIGDVLIGDKSTGFCAPGCQAFADSGTSLLSG 198

CARDE_CYNCA1.82e-1258.82%
Cardosin-E (Fragments) OS=Cynara cardunc...
HSP 1
Score: 71.2478 bits (173), Expect = 1.81664e-12
Identity = 30/51 (58.82%), Postives = 37/51 (72.55%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HF+G TYVP+T + YWQF + D +IG+ STG+C GC A DSGTSLL G
Sbjct: 92 HFRGDHTYVPVTYQYYWQFGIGDVLIGDKSTGFCAPGCQAFADSGTSLLSG 142

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CF811398
Best 10 Hits Shown

Match Name E value Identity Description
Q06EY4_IPOBA7.41e-2084.31%
Aspartic protease OS=Ipomoea batatas PE=...
HSP 1
Score: 100.138 bits (248), Expect = 7.40902e-20
Identity = 43/51 (84.31%), Postives = 47/51 (92.16%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKGK TYVP+TQKGYWQFEM DF+IGN STG+C+GGCAAIVDSGTSLL G
Sbjct: 243 HFKGKHTYVPVTQKGYWQFEMGDFLIGNSSTGFCEGGCAAIVDSGTSLLTG 293

Q6B9W9_SOLTU2.38e-1882.35%Asp OS=Solanum tuberosum PE=2 SV=1
HSP 1
Score: 95.1301 bits (235), Expect = 2.3834e-18
Identity = 42/51 (82.35%), Postives = 44/51 (86.27%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKG TYVP+TQKGYWQF M DF+IGN STGYC GGCAAIVDSGTSLL G
Sbjct: 234 HFKGNHTYVPLTQKGYWQFNMGDFLIGNTSTGYCAGGCAAIVDSGTSLLAG 284

Q2VCI9_SOLTU2.38e-1882.35%
Aspartic protease-like OS=Solanum tubero...
HSP 1
Score: 95.1301 bits (235), Expect = 2.3834e-18
Identity = 42/51 (82.35%), Postives = 44/51 (86.27%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKG TYVP+TQKGYWQF M DF+IGN STGYC GGCAAIVDSGTSLL G
Sbjct: 246 HFKGNHTYVPLTQKGYWQFNMGDFLIGNTSTGYCAGGCAAIVDSGTSLLAG 296

B9I6C6_POPTR2.38e-1880.39%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 95.1301 bits (235), Expect = 2.3834e-18
Identity = 41/51 (80.39%), Postives = 44/51 (86.27%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKGK TYVP+TQKGYWQ M DF+IG HSTG C+GGCAAIVDSGTSLL G
Sbjct: 246 HFKGKHTYVPVTQKGYWQINMGDFLIGKHSTGLCEGGCAAIVDSGTSLLAG 296

B1Q478_CAPCH2.38e-1882.35%
Putative aspartic protease OS=Capsicum c...
HSP 1
Score: 95.1301 bits (235), Expect = 2.3834e-18
Identity = 42/51 (82.35%), Postives = 44/51 (86.27%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKG TYVP+TQKGYWQF M DF+IGN STGYC GGCAAIVDSGTSLL G
Sbjct: 246 HFKGNHTYVPLTQKGYWQFNMGDFLIGNTSTGYCAGGCAAIVDSGTSLLAG 296

Q93XR0_IPOBA5.31e-1876.47%
Putative aspartic protease OS=Ipomoea ba...
HSP 1
Score: 93.9745 bits (232), Expect = 5.30966e-18
Identity = 39/51 (76.47%), Postives = 45/51 (88.24%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKG+ TYVP+TQKGYWQ ++ DF+IGN STGYC+GGCA IVDSGTSLL G
Sbjct: 245 HFKGEHTYVPVTQKGYWQIDLGDFLIGNSSTGYCEGGCAVIVDSGTSLLTG 295

B8LRP2_PICSI2.02e-1776.47%
Putative uncharacterized protein OS=Pice...
HSP 1
Score: 92.0485 bits (227), Expect = 2.01767e-17
Identity = 39/51 (76.47%), Postives = 44/51 (86.27%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKGK TYVP+T++GYWQF M DF+IG STG+C GGCAAIVDSGTSLL G
Sbjct: 249 HFKGKHTYVPVTREGYWQFNMGDFLIGGQSTGFCSGGCAAIVDSGTSLLAG 299

B8LKS9_PICSI2.02e-1776.47%
Putative uncharacterized protein OS=Pice...
HSP 1
Score: 92.0485 bits (227), Expect = 2.01767e-17
Identity = 39/51 (76.47%), Postives = 44/51 (86.27%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKGK TYVP+T++GYWQF M DF+IG STG+C GGCAAIVDSGTSLL G
Sbjct: 249 HFKGKHTYVPVTREGYWQFNMGDFLIGGQSTGFCSGGCAAIVDSGTSLLAG 299

Q40140_SOLLC2.64e-1780.39%
Aspartic protease OS=Solanum lycopersicu...
HSP 1
Score: 91.6633 bits (226), Expect = 2.63516e-17
Identity = 41/51 (80.39%), Postives = 43/51 (84.31%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKG T VP+TQKGYWQF M DF+IGN STGYC GGCAAIVDSGTSLL G
Sbjct: 246 HFKGNHTCVPLTQKGYWQFNMGDFLIGNTSTGYCAGGCAAIVDSGTSLLAG 296

Q2HRQ7_MEDTR4.49e-1778.43%
Peptidase A1, pepsin OS=Medicago truncat...
HSP 1
Score: 90.8929 bits (224), Expect = 4.49489e-17
Identity = 40/51 (78.43%), Postives = 43/51 (84.31%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKGK TYVP+T+KGYWQ EM DF IG STG C+GGCAAIVDSGTSLL G
Sbjct: 136 HFKGKHTYVPVTEKGYWQIEMGDFFIGGLSTGVCEGGCAAIVDSGTSLLAG 186

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CF811398
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010313270012.28e-1872.55%GSVIVT01031327001 assembled CDS
HSP 1
Score: 86.6557 bits (213), Expect = 2.28273e-18
Identity = 37/51 (72.55%), Postives = 43/51 (84.31%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKG+ TY ITQKGYWQFEM +F+IG STG+C+ GCAAIVDSGTSL+ G
Sbjct: 168 HFKGQHTYASITQKGYWQFEMGEFLIGYQSTGFCEAGCAAIVDSGTSLIAG 218

GSVIVT010313290012.98e-1868.63%GSVIVT01031329001 assembled CDS
HSP 1
Score: 86.2705 bits (212), Expect = 2.98134e-18
Identity = 35/51 (68.63%), Postives = 43/51 (84.31%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HF+GK T+VP+TQ GYWQF M DF+I N +TG C+GGC+AIVDSGTSL+ G
Sbjct: 246 HFRGKHTFVPVTQAGYWQFRMGDFLISNQTTGVCEGGCSAIVDSGTSLIAG 296

GSVIVT010126840015.09e-1870.59%GSVIVT01012684001 assembled CDS
HSP 1
Score: 85.5001 bits (210), Expect = 5.0854e-18
Identity = 36/51 (70.59%), Postives = 42/51 (82.35%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKG+ TYVP+TQKGYWQF+M + +I +TGYC GGCAAI DSGTSLL G
Sbjct: 168 HFKGEHTYVPVTQKGYWQFDMGEVLIDGETTGYCAGGCAAIADSGTSLLAG 218

GSVIVT010376850012.52e-1766.67%GSVIVT01037685001 assembled CDS
HSP 1
Score: 83.1889 bits (204), Expect = 2.52386e-17
Identity = 34/51 (66.67%), Postives = 42/51 (82.35%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
H+KGK TYVP+T+KGYWQF++ D MIG +TG+C GC+AI DSGTSLL G
Sbjct: 253 HYKGKHTYVPVTKKGYWQFDLGDVMIGGKTTGFCASGCSAIADSGTSLLAG 303

GSVIVT010177010013.09e-1560.78%GSVIVT01017701001 assembled CDS
HSP 1
Score: 76.2554 bits (186), Expect = 3.08521e-15
Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HF G T+VPIT+K YWQ E+ D +I STG+C+GGCAAIVD+GTS++ G
Sbjct: 246 HFMGDHTFVPITRKDYWQIEVGDILIAGSSTGFCEGGCAAIVDTGTSMIAG 296

GSVIVT010244590012.44e-1268.29%GSVIVT01024459001 assembled CDS
HSP 1
Score: 66.6254 bits (161), Expect = 2.44455e-12
Identity = 28/41 (68.29%), Postives = 34/41 (82.93%), Query Frame = 3
Query:   33 ITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
ITQKGYWQFEM +F+IG ST +C+ GCAAI+DS TSL+ G
Sbjct: 22 ITQKGYWQFEMGEFLIGYQSTSFCEAGCAAIIDSRTSLIAG 62

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CF811398
Best 10 Hits Shown

Match Name E value Identity Description
AT1G11910.1 4.36e-1870.59%
aspartic proteinase A1 | chr1:4017119-4...
HSP 1
Score: 86.2705 bits (212), Expect = 4.35964e-18
Identity = 36/51 (70.59%), Postives = 42/51 (82.35%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKGK TYVP+TQKGYWQF+M D +IG TG+C+ GC+AI DSGTSLL G
Sbjct: 245 HFKGKHTYVPVTQKGYWQFDMGDVLIGGAPTGFCESGCSAIADSGTSLLAG 295

AT1G62290.2 3.12e-1662.75%
Saposin-like aspartyl protease family p...
HSP 1
Score: 80.1073 bits (196), Expect = 3.12433e-16
Identity = 32/51 (62.75%), Postives = 41/51 (80.39%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HF+G+ T+VP+TQ+GYWQF+M + +I STGYC GC+AI DSGTSLL G
Sbjct: 252 HFRGEHTFVPVTQRGYWQFDMGEVLIAGESTGYCGSGCSAIADSGTSLLAG 302

AT1G62290.1 3.12e-1662.75%
Saposin-like aspartyl protease family p...
HSP 1
Score: 80.1073 bits (196), Expect = 3.12433e-16
Identity = 32/51 (62.75%), Postives = 41/51 (80.39%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HF+G+ T+VP+TQ+GYWQF+M + +I STGYC GC+AI DSGTSLL G
Sbjct: 252 HFRGEHTFVPVTQRGYWQFDMGEVLIAGESTGYCGSGCSAIADSGTSLLAG 302

AT4G04460.2 9.09e-1664.71%
Saposin-like aspartyl protease family p...
HSP 1
Score: 78.5666 bits (192), Expect = 9.0904e-16
Identity = 33/51 (64.71%), Postives = 38/51 (74.51%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKG+ T+VP+T KGYWQF+M D I TGYC GC+AI DSGTSLL G
Sbjct: 250 HFKGEHTFVPVTHKGYWQFDMGDLQIAGKPTGYCAKGCSAIADSGTSLLTG 300

AT4G04460.1 9.09e-1664.71%
Saposin-like aspartyl protease family p...
HSP 1
Score: 78.5666 bits (192), Expect = 9.0904e-16
Identity = 33/51 (64.71%), Postives = 38/51 (74.51%), Query Frame = 3
Query:    3 HFKGKRTYVPITQKGYWQFEMDDFMIGNHSTGYCDGGCAAIVDSGTSLLDG 155
HFKG+ T+VP+T KGYWQF+M D I TGYC GC+AI DSGTSLL G
Sbjct: 250 HFKGEHTFVPVTHKGYWQFDMGDLQIAGKPTGYCAKGCSAIADSGTSLLTG 300

Related info for CF811398