CV090964

Information for CV090964

NameCV090964
AccessionID2313
Length558 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014531 cDNA non acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CV090964
Sequence
GGCAGATTTGAGATCCAGAGAAACCGAGACATGGGTTTGCAGGAGGACTTTGATGAGCAT
GCCACGAAAGCCAAGACCCTGCCCGAGAGTACTACTAATGAAAACAAGCTTATTCTGTAT
GGATTGTTCAAGCAAGCCACTGTTGGACCAGTGAACACTAGCCGCCCAGGTATGTTCAAC
ATGAAGGACAGGGCTAAGTGGGATGCATGGAAGGCTGTTGAAGGAAAATCCAAGGAGGAA
GCAATGAGTGACTACATCACTAAGGTGAAACAGTTGCAGGAAGAGGCTGGTTCTGCTTGA
TGGTGTGAAGCTTGTGTTTCTTCCTGATAAGTTTGTTTCGTCGAAGATGAAATAAGGAAC
ATTCGTTGTTTCACTGCTAGTATTGTATCATCCTTTCCGAATTCCGTGTACTTGGATCAG
ATATGTTAAGGTTTAGTGGCCGTGGTCGCAGCTAATGGAAGTGAGTGTTTGTGCTTTTAG
TTTCTTGTGGTTTAACTTTGAAACTGTACCTGGTAAAATCTGAACATCACCATGAATGCA
TTATAATTTGATTCGTCT
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0000062 molecular_function acyl-CoA binding
GO:0005488 molecular_function binding

KEGG Analysis

Analysis Date: 01-18-2011 (KEGG analysis for Vaccinium corymbosum unigene v1)
K08762 DBI, ACBP; diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein)

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CV090964_1_ORF1 CRC64: A60A5D5BDFD9C129 LENGTH: 99 aa
InterPro
IPR000582
Domain
Acyl-CoA-binding protein, ACBP
PR00689 [14-29]T 1.6e-28 PR00689 ACOABINDINGP[31-49]T 1.6e-28 PR00689 ACOABINDINGP[54-69]T 1.6e-28 PR00689 ACOABINDINGP[75-92]T 1.6e-28 PR00689 ACOABINDINGP ACOABINDINGP
PTHR23310 [31-95]T 6.1e-35 PTHR23310 ACYL-COA-BINDING PROTEIN, ACBP ACYL-COA-BINDING PROTEIN, ACBP
PF00887 [13-95]T 1.8e-31 PF00887 ACBP ACBP
PS51228 [13-98]T 43.306 PS51228 ACB_2 ACB_2
SSF47027 [13-98]T 5.6e-30 SSF47027 Acyl-CoA binding protein Acyl-CoA binding protein
InterPro
IPR014352
Domain
FERM/acyl-CoA-binding protein, 3-helical bundle
G3DSA:1.20.80.10 [12-96]T 7.3e-33 G3DSA:1.20.80.10 no description no description
InterPro
IPR022408
Conserved_site
Acyl-CoA-binding protein, ACBP, conserved site
PS00880 [31-49]T NA PS00880 ACB_1 ACB_1
noIPR
unintegrated
unintegrated
PTHR23310:SF10 [31-95]T 6.1e-35 PTHR23310:SF10 ACYL COA BINDING PROTEIN ACYL COA BINDING PROTEIN

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CV090964
Best 10 Hits Shown

Match Name E value Identity Description
ppa014021m 3.14e-4085.39%ppa014021m
HSP 1
Score: 160.999 bits (406), Expect = 3.14305e-40
Identity = 76/89 (85.39%), Postives = 85/89 (95.51%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGL+E+FDE+A KAKTLPESTTNENKLILYGL+KQATVG VNTSRPG+FNM+DRAKWDAWKAVEGKSKEEAM DY+TKVKQL EEAG++
Sbjct: 1 MGLKEEFDEYAEKAKTLPESTTNENKLILYGLYKQATVGAVNTSRPGIFNMRDRAKWDAWKAVEGKSKEEAMGDYVTKVKQLLEEAGAS 89

ppa025204m 1.32e-3068.54%ppa025204m
HSP 1
Score: 129.028 bits (323), Expect = 1.32358e-30
Identity = 61/89 (68.54%), Postives = 75/89 (84.27%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
M LQE+F E+A KAK+LP +T + +KLILYGL+KQATVG VNT+RPG F+ +RAKWDAWKA EGKSKEEAM++YI KVKQLQ+ G+A
Sbjct: 1 MALQEEFKEYAEKAKSLPPATKDADKLILYGLYKQATVGSVNTNRPGFFSPTERAKWDAWKAAEGKSKEEAMTEYIAKVKQLQQVEGAA 89

ppa002406m 1.68e-0939.19%ppa002406m
HSP 1
Score: 58.9214 bits (141), Expect = 1.68212e-09
Identity = 29/74 (39.19%), Postives = 45/74 (60.81%), Query Frame = 1
Query:   64 TKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEE 285
+ +K + +E+ LILY L++QATVGP NT P +N +++KW +WK + + EAM + VK L+EE
Sbjct: 31 SSSKAVRSKFNSESALILYALYQQATVGPCNTPEPSAWNAIEKSKWSSWKKLADMASTEAMRLF---VKILEEE 101

ppa007972m 1.09e-0840.58%ppa007972m
HSP 1
Score: 56.225 bits (134), Expect = 1.09032e-08
Identity = 28/69 (40.58%), Postives = 39/69 (56.52%), Query Frame = 1
Query:   70 AKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQL 276
A T + +N+ +L LYGL+K AT GP + +P M RAKW AW+ + E+AM YI V +L
Sbjct: 119 AATDRQKVSNDAQLQLYGLYKIATEGPCSVPQPSALKMTARAKWQAWQKLGAMPPEDAMEKYIDIVTEL 187

ppa007917m 1.09e-0840.58%ppa007917m
HSP 1
Score: 56.225 bits (134), Expect = 1.09032e-08
Identity = 28/69 (40.58%), Postives = 39/69 (56.52%), Query Frame = 1
Query:   70 AKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQL 276
A T + +N+ +L LYGL+K AT GP + +P M RAKW AW+ + E+AM YI V +L
Sbjct: 119 AATDRQKVSNDAQLQLYGLYKIATEGPCSVPQPSALKMTARAKWQAWQKLGAMPPEDAMEKYIDIVTEL 187

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CV090964
Best 10 Hits Shown

Match Name E value Identity Description
ACBP_RICCO2.79e-3986.52%
Acyl-CoA-binding protein OS=Ricinus comm...
HSP 1
Score: 161.384 bits (407), Expect = 2.79176e-39
Identity = 77/89 (86.52%), Postives = 84/89 (94.38%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGL+EDF+EHA KAKTLPE+TTNENKLILYGL+KQATVGPVNTSRPGMFNM+DRAKWDAWKAVEGKS EEAMSDYITKVKQL EA ++
Sbjct: 1 MGLKEDFEEHAEKAKTLPENTTNENKLILYGLYKQATVGPVNTSRPGMFNMRDRAKWDAWKAVEGKSTEEAMSDYITKVKQLLGEAAAS 89

ACBP_FRIAG2.45e-3580.23%
Acyl-CoA-binding protein OS=Fritillaria ...
HSP 1
Score: 148.288 bits (373), Expect = 2.4457e-35
Identity = 69/86 (80.23%), Postives = 80/86 (93.02%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEA 288
M L+E+F+EHA KAKTLPEST+NENKLILYGL+KQ+TVGPV+T RPGMF+ ++RAKWDAWKAVEGKSKEEAM DYITKVKQL EE+
Sbjct: 1 MALKEEFEEHAVKAKTLPESTSNENKLILYGLYKQSTVGPVDTGRPGMFSPRERAKWDAWKAVEGKSKEEAMGDYITKVKQLLEES 86

ACBP_GOSHI1.21e-3476.40%
Acyl-CoA-binding protein OS=Gossypium hi...
HSP 1
Score: 145.976 bits (367), Expect = 1.21379e-34
Identity = 68/89 (76.40%), Postives = 80/89 (89.89%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGL+E+F+EHA K KTLP + +N++ LILYGL+KQATVGPVNTSRPGMFNM+++ KWDAWKAVEGKSKEEAM DYITKVKQL E AGS+
Sbjct: 1 MGLKEEFEEHAEKVKTLPAAPSNDDMLILYGLYKQATVGPVNTSRPGMFNMREKYKWDAWKAVEGKSKEEAMGDYITKVKQLFEAAGSS 89

ACBP_BRANA1.14e-3277.78%
Acyl-CoA-binding protein OS=Brassica nap...
HSP 1
Score: 139.428 bits (350), Expect = 1.13607e-32
Identity = 70/90 (77.78%), Postives = 78/90 (86.67%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQE-EAGSA 297
MGL+EDF+EHA K K L S +NE+ LILYGL+KQATVGPV TSRPGMF+MK+RAKWDAWKAVEGKS +EAMSDYITKVKQL E EA SA
Sbjct: 1 MGLKEDFEEHAEKVKKLTASPSNEDLLILYGLYKQATVGPVTTSRPGMFSMKERAKWDAWKAVEGKSTDEAMSDYITKVKQLLEAEASSA 90

ACBP6_ARATH2.14e-3173.86%
Acyl-CoA-binding domain-containing prote...
HSP 1
Score: 135.191 bits (339), Expect = 2.14254e-31
Identity = 65/88 (73.86%), Postives = 75/88 (85.23%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGS 294
MGL+E+F+EHA K TL E +NE+ LILYGL+KQA GPV+TSRPGMF+MK+RAKWDAWKAVEGKS EEAM+DYITKVKQL E A S
Sbjct: 1 MGLKEEFEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAWKAVEGKSSEEAMNDYITKVKQLLEVAAS 88

ACBP_RAT2.72e-1848.81%
Acyl-CoA-binding protein OS=Rattus norve...
HSP 1
Score: 91.6633 bits (226), Expect = 2.71661e-18
Identity = 41/84 (48.81%), Postives = 58/84 (69.05%), Query Frame = 1
Query:   40 QEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAG 291
Q DFD+ A + K L T+E L +Y FKQATVG VNT RPG+ ++K +AKWD+W ++G SKE AM Y+ KV++L+++ G
Sbjct: 3 QADFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKENAMKTYVEKVEELKKKYG 86

ACBP_MOUSE1.35e-1747.62%
Acyl-CoA-binding protein OS=Mus musculus...
HSP 1
Score: 89.3521 bits (220), Expect = 1.34824e-17
Identity = 40/84 (47.62%), Postives = 57/84 (67.86%), Query Frame = 1
Query:   40 QEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAG 291
Q +FD+ A + K L T+E L +Y FKQATVG VNT RPG+ ++K +AKWD+W ++G SKE AM Y+ KV +L+++ G
Sbjct: 3 QAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYG 86

ACBP_CHAVI1.76e-1746.43%
Acyl-CoA-binding protein OS=Chaetophract...
HSP 1
Score: 88.9669 bits (219), Expect = 1.76085e-17
Identity = 39/84 (46.43%), Postives = 57/84 (67.86%), Query Frame = 1
Query:   40 QEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAG 291
Q +FD+ A + K L ++ L +Y +KQATVG +NT RPGM + K +AKWDAW ++G SKE+AM YI KV++L+++ G
Sbjct: 3 QAEFDKAAEEVKNLKTKPADDEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNQLKGTSKEDAMKSYIDKVEELKKKYG 86

ACBP_BOVIN2.30e-1747.62%
Acyl-CoA-binding protein OS=Bos taurus G...
HSP 1
Score: 88.5817 bits (218), Expect = 2.29975e-17
Identity = 40/84 (47.62%), Postives = 57/84 (67.86%), Query Frame = 1
Query:   40 QEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAG 291
Q +FD+ A + K L +E L +Y +KQATVG +NT RPGM + K +AKWDAW ++G SKE+AM YI KV++L+++ G
Sbjct: 3 QAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYG 86

ACBP_HYPDU3.92e-1747.19%
Putative acyl-CoA-binding protein OS=Hyp...
HSP 1
Score: 87.8113 bits (216), Expect = 3.92277e-17
Identity = 42/89 (47.19%), Postives = 57/89 (64.04%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
M ++E F A + K L S ++ L LY L+KQAT+G VNT RPGM +K++AKWDAW +G KE+A Y+ KVK+L E+ G A
Sbjct: 1 MSVEEQFKTSAEQVKKLKSSPSDTELLELYSLYKQATIGDVNTDRPGMLYLKEKAKWDAWNGRKGLGKEQAQELYVKKVKELVEKNGLA 89

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CV090964
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0003s102701.99e-4087.64%POPTR_0003s10270.2
HSP 1
Score: 162.155 bits (409), Expect = 1.9871e-40
Identity = 78/89 (87.64%), Postives = 85/89 (95.51%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGLQE+F+EHA KAKTLPE+TTNENKLILYGLFKQATVG VNTSRPG+FNM+DRAKWDAWKAVEGKSKEEAMSDYITKVKQL EEA ++
Sbjct: 1 MGLQEEFEEHAEKAKTLPENTTNENKLILYGLFKQATVGLVNTSRPGIFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLLEEAAAS 89

POPTR_0001s012304.43e-4085.39%POPTR_0001s01230.1
HSP 1
Score: 160.999 bits (406), Expect = 4.42679e-40
Identity = 76/89 (85.39%), Postives = 84/89 (94.38%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGLQE+F EH+ KAKTLPE+TTNENKLILYGL+KQATVGPVNTSRPG+FNM+DRAKWDAWKAVEG SKEEAMSDYITKVKQL EEA ++
Sbjct: 1 MGLQEEFQEHSEKAKTLPENTTNENKLILYGLYKQATVGPVNTSRPGIFNMRDRAKWDAWKAVEGNSKEEAMSDYITKVKQLLEEAAAS 89

POPTR_0003s102701.42e-3882.98%POPTR_0003s10270.1
HSP 1
Score: 155.992 bits (393), Expect = 1.42405e-38
Identity = 78/94 (82.98%), Postives = 85/94 (90.43%), Query Frame = 1
Query:   31 MGLQ-----EDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGLQ E+F+EHA KAKTLPE+TTNENKLILYGLFKQATVG VNTSRPG+FNM+DRAKWDAWKAVEGKSKEEAMSDYITKVKQL EEA ++
Sbjct: 1 MGLQVQQSYEEFEEHAEKAKTLPENTTNENKLILYGLFKQATVGLVNTSRPGIFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLLEEAAAS 94

POPTR_0005s027001.54e-0832.91%POPTR_0005s02700.1
HSP 1
Score: 56.225 bits (134), Expect = 1.53565e-08
Identity = 26/79 (32.91%), Postives = 44/79 (55.70%), Query Frame = 1
Query:   49 FDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEE 285
FD T+ N+ L+LY L++QAT+GP N +P + +++KW +W+ +E + EAM + VK L+E+
Sbjct: 27 FDGSHNSTTTVSSKFQNDTALLLYALYQQATIGPCNVPKPSSWKAVEQSKWKSWQGLENMASTEAMRLF---VKILEED 102

POPTR_0013s019505.84e-0832.91%POPTR_0013s01950.2
HSP 1
Score: 54.299 bits (129), Expect = 5.83545e-08
Identity = 26/79 (32.91%), Postives = 43/79 (54.43%), Query Frame = 1
Query:   49 FDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEE 285
FD T+ N+ L+LY L++QATVGP N +P + +++KW +W+ + + EAM + VK L+E+
Sbjct: 25 FDGSHNSTSTVSSKFQNDTALLLYALYQQATVGPCNVPKPSSWKAVEQSKWKSWQGLGNMASTEAMRLF---VKILEED 100

POPTR_0013s019505.84e-0832.91%POPTR_0013s01950.1
HSP 1
Score: 54.299 bits (129), Expect = 5.83545e-08
Identity = 26/79 (32.91%), Postives = 43/79 (54.43%), Query Frame = 1
Query:   49 FDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEE 285
FD T+ N+ L+LY L++QATVGP N +P + +++KW +W+ + + EAM + VK L+E+
Sbjct: 25 FDGSHNSTSTVSSKFQNDTALLLYALYQQATVGPCNVPKPSSWKAVEQSKWKSWQGLGNMASTEAMRLF---VKILEED 100

POPTR_0012s024808.43e-0737.50%POPTR_0012s02480.1
HSP 1
Score: 50.447 bits (119), Expect = 8.42637e-07
Identity = 27/72 (37.50%), Postives = 37/72 (51.39%), Query Frame = 1
Query:   61 ATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQL 276
AT A +++ +L LYG +K AT GP + P M RAKW AW+ + E+AM YI V +L
Sbjct: 11 ATAADRNSLKVSSDLQLQLYGYYKIATEGPCTSPPPSALKMTARAKWQAWQKLGAMPPEDAMQKYIDIVTEL 82

POPTR_0015s012508.43e-0734.72%POPTR_0015s01250.1
HSP 1
Score: 50.447 bits (119), Expect = 8.42637e-07
Identity = 25/72 (34.72%), Postives = 38/72 (52.78%), Query Frame = 1
Query:   61 ATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQL 276
A A + +++ +L LYG +K AT GP ++ P M RAKW AW+ + E+AM YI + +L
Sbjct: 119 AAAADRVSLKVSSDLQLQLYGYYKIATEGPCTSAPPSALKMTARAKWQAWQKLGAMPPEDAMQKYIDIITEL 190

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CV090964
Best 10 Hits Shown

Match Name E value Identity Description
Q8RVT5_PANGI7.51e-3990.70%
Acyl-CoA-binding protein OS=Panax ginsen...
HSP 1
Score: 163.696 bits (413), Expect = 7.51089e-39
Identity = 78/86 (90.70%), Postives = 83/86 (96.51%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEA 288
MGLQE+F+EHA KAKTLPESTTNENKLILYGL+KQATVGPVNTSRPG+FNM+DRAKWDAWKAVEGKSKEEAM DYITKVKQL EEA
Sbjct: 1 MGLQEEFEEHAEKAKTLPESTTNENKLILYGLYKQATVGPVNTSRPGIFNMRDRAKWDAWKAVEGKSKEEAMGDYITKVKQLLEEA 86

B9MUD8_POPTR1.28e-3886.52%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 162.925 bits (411), Expect = 1.28116e-38
Identity = 77/89 (86.52%), Postives = 85/89 (95.51%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGLQE+F EH+ KAKTLPE+TTNENKLILYGL+KQATVGPVNTSRPG+FNM+DRAKWDAWKAVEGKSKEEAMSDYITKVKQL EEA ++
Sbjct: 1 MGLQEEFQEHSEKAKTLPENTTNENKLILYGLYKQATVGPVNTSRPGIFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLLEEAAAS 89

D6BR55_9ROSI2.19e-3887.64%
Acyl-CoA-binding protein (Fragment) OS=J...
HSP 1
Score: 162.155 bits (409), Expect = 2.18533e-38
Identity = 78/89 (87.64%), Postives = 85/89 (95.51%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGL+E+F+E+A KAKTLPE+TTNENKLILYGLFKQATVGPVNTSRPGMFNM+DRAKWDAWKAVEGKSKEEAMSDYITKVK L EEA +A
Sbjct: 1 MGLKEEFEEYAEKAKTLPENTTNENKLILYGLFKQATVGPVNTSRPGMFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKLLLEEAAAA 89

B9GZX2_POPTR2.19e-3887.64%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 162.155 bits (409), Expect = 2.18533e-38
Identity = 78/89 (87.64%), Postives = 85/89 (95.51%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGLQE+F+EHA KAKTLPE+TTNENKLILYGLFKQATVG VNTSRPG+FNM+DRAKWDAWKAVEGKSKEEAMSDYITKVKQL EEA ++
Sbjct: 1 MGLQEEFEEHAEKAKTLPENTTNENKLILYGLFKQATVGLVNTSRPGIFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLLEEAAAS 89

Q0GYN5_9ROSI4.87e-3887.64%
Acyl-CoA-binding protein OS=Jatropha cur...
HSP 1
Score: 160.999 bits (406), Expect = 4.86842e-38
Identity = 78/89 (87.64%), Postives = 84/89 (94.38%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGL+EDF+E+A KAKTLPE+TTNENKLILYGLFKQATVGPVNTSRPGMFNM+DRAKW AWKAVEGKSKEEAMSDYITKVK L EEA +A
Sbjct: 1 MGLKEDFEEYAEKAKTLPENTTNENKLILYGLFKQATVGPVNTSRPGMFNMRDRAKWGAWKAVEGKSKEEAMSDYITKVKLLLEEAAAA 89

A9PD27_POPTR4.87e-3885.39%
Putative uncharacterized protein OS=Popu...
HSP 1
Score: 160.999 bits (406), Expect = 4.86842e-38
Identity = 76/89 (85.39%), Postives = 84/89 (94.38%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGLQE+F EH+ KAKTLPE+TTNENKLILYGL+KQATVGPVNTSRPG+FNM+DRAKWDAWKAVEG SKEEAMSDYITKVKQL EEA ++
Sbjct: 1 MGLQEEFQEHSEKAKTLPENTTNENKLILYGLYKQATVGPVNTSRPGIFNMRDRAKWDAWKAVEGNSKEEAMSDYITKVKQLLEEAAAS 89

Q7XJJ8_TROMA7.03e-3783.15%
Acyl-CoA-binding protein OS=Tropaeolum m...
HSP 1
Score: 157.147 bits (396), Expect = 7.02998e-37
Identity = 74/89 (83.15%), Postives = 83/89 (93.26%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGLQE+F+EHA KAKTLPEST+NENKLILYGL+KQATVGPVNTSRPG+FNMKDRAKWDAWKAVE KSKE+ M+DYI KVKQL EEA ++
Sbjct: 1 MGLQEEFEEHAEKAKTLPESTSNENKLILYGLYKQATVGPVNTSRPGIFNMKDRAKWDAWKAVEAKSKEDVMTDYIPKVKQLLEEAAAS 89

B4FER8_MAIZE1.20e-3683.15%
Acyl-CoA-binding protein OS=Zea mays PE=...
HSP 1
Score: 156.377 bits (394), Expect = 1.19913e-36
Identity = 74/89 (83.15%), Postives = 83/89 (93.26%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGLQE+F+EHA KAKTLPEST+NENKLILYGL+KQATVG VNT RPG+F KDRAKWDAWKAVEGKSK+EAM+DYITKVKQLQEEA ++
Sbjct: 1 MGLQEEFEEHAEKAKTLPESTSNENKLILYGLYKQATVGDVNTDRPGIFYQKDRAKWDAWKAVEGKSKDEAMNDYITKVKQLQEEAAAS 89

Q9SMG5_DIGLA2.67e-3680.43%
Acyl-CoA binding protein (ACBP) OS=Digit...
HSP 1
Score: 155.221 bits (391), Expect = 2.67139e-36
Identity = 74/92 (80.43%), Postives = 85/92 (92.39%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA*WC 306
MGL+E+F+EHA KAKTLPE+T+N NKLILYGL+KQATVG VNTSRPG+FNM+DRAKWDAWKAVEGKS+EEAM+DYITKVKQL EEA +A C
Sbjct: 1 MGLKEEFEEHAEKAKTLPENTSNANKLILYGLYKQATVGNVNTSRPGVFNMRDRAKWDAWKAVEGKSQEEAMADYITKVKQLLEEAAAAASC 92

B6UB43_MAIZE2.67e-3682.02%
Acyl-CoA-binding protein OS=Zea mays PE=...
HSP 1
Score: 155.221 bits (391), Expect = 2.67139e-36
Identity = 73/89 (82.02%), Postives = 83/89 (93.26%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGLQE+F+EHA KAKTLPE+T+NENKLILYGL+KQATVG VNT RPG+F KDRAKWDAWKAVEGKSK+EAM+DYITKVKQLQEEA ++
Sbjct: 1 MGLQEEFEEHAEKAKTLPENTSNENKLILYGLYKQATVGDVNTDRPGIFYQKDRAKWDAWKAVEGKSKDEAMNDYITKVKQLQEEAAAS 89

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CV090964
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010228040019.58e-3880.90%GSVIVT01022804001 assembled CDS
HSP 1
Score: 152.525 bits (384), Expect = 9.58235e-38
Identity = 72/89 (80.90%), Postives = 84/89 (94.38%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGSA 297
MGL+E+F+E+A KAKTLPE+TTNENKLILYGL+KQATVG VNTSRPG+FN+++RAKWDAWKAVEGKS EEAM+DYITKVKQL EEA +A
Sbjct: 1 MGLKEEFEEYAEKAKTLPENTTNENKLILYGLYKQATVGNVNTSRPGIFNLRERAKWDAWKAVEGKSTEEAMNDYITKVKQLLEEAAAA 89

GSVIVT010151050011.75e-2380.00%GSVIVT01015105001 assembled CDS
HSP 1
Score: 105.145 bits (261), Expect = 1.75443e-23
Identity = 48/60 (80.00%), Postives = 57/60 (95.00%), Query Frame = 1
Query:  103 NKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQE 282
+KL+LYGL+KQATVG V+T+RPG+F+ K+RAKWDAWKAVEGK+KEEAMSDYI KVKQLQE
Sbjct: 4 DKLVLYGLYKQATVGTVDTNRPGIFSPKERAKWDAWKAVEGKTKEEAMSDYIVKVKQLQE 63

GSVIVT010385820012.22e-1043.06%GSVIVT01038582001 assembled CDS
HSP 1
Score: 61.6178 bits (148), Expect = 2.22452e-10
Identity = 31/72 (43.06%), Postives = 41/72 (56.94%), Query Frame = 1
Query:   61 ATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQL 276
AT A L + +N+ +L LYGL+K AT GP + +P M RAKW AW+ + EEAM YI V +L
Sbjct: 113 ATAADRLSQKVSNDVQLQLYGLYKIATEGPCSAPQPSALKMTARAKWQAWQKLGAMPPEEAMQKYIAIVTEL 184

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CV090964
Best 10 Hits Shown

Match Name E value Identity Description
AT1G31812.1 2.29e-3273.86%
acyl-CoA-binding protein 6 | chr1:11411...
HSP 1
Score: 135.191 bits (339), Expect = 2.29384e-32
Identity = 65/88 (73.86%), Postives = 75/88 (85.23%), Query Frame = 1
Query:   31 MGLQEDFDEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGS 294
MGL+E+F+EHA K TL E +NE+ LILYGL+KQA GPV+TSRPGMF+MK+RAKWDAWKAVEGKS EEAM+DYITKVKQL E A S
Sbjct: 1 MGLKEEFEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAWKAVEGKSSEEAMNDYITKVKQLLEVAAS 88

AT5G53470.1 7.18e-1043.06%
acyl-CoA binding protein 1 | chr5:21710...
HSP 1
Score: 60.4622 bits (145), Expect = 7.18041e-10
Identity = 31/72 (43.06%), Postives = 39/72 (54.17%), Query Frame = 1
Query:   61 ATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQL 276
A + L + +NE +L LYGL+K AT GP +P M RAKW AW+ + EEAM YI V QL
Sbjct: 107 AAASDRLSQKVSNELQLQLYGLYKIATEGPCTAPQPSALKMTARAKWQAWQKLGAMPPEEAMEKYIDLVTQL 178

AT4G27780.1 6.72e-0840.58%
acyl-CoA binding protein 2 | chr4:13847...
HSP 1
Score: 53.9138 bits (128), Expect = 6.72066e-08
Identity = 28/69 (40.58%), Postives = 36/69 (52.17%), Query Frame = 1
Query:   70 AKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQL 276
A L + ++ + LYGL+K AT GP +P M RAKW AW+ + EEAM YI V QL
Sbjct: 120 ADRLSQKVPSDVQQQLYGLYKIATEGPCTAPQPSALKMTARAKWQAWQKLGAMPPEEAMEKYIEIVTQL 188

AT3G05420.2 7.43e-0733.33%
acyl-CoA binding protein 4 | chr3:15618...
HSP 1
Score: 50.447 bits (119), Expect = 7.43056e-07
Identity = 26/78 (33.33%), Postives = 44/78 (56.41%), Query Frame = 1
Query:   52 DEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEE 285
D + AK + ++ L+LY L++QATVGP NT +P + +++KW +W+ + EAM + VK L+E+
Sbjct: 26 DGSDSSAKNVISKFPDDTALLLYALYQQATVGPCNTPKPSAWRPVEQSKWKSWQGLGTMPSIEAMRLF---VKILEED 100

AT3G05420.1 7.43e-0733.33%
acyl-CoA binding protein 4 | chr3:15618...
HSP 1
Score: 50.447 bits (119), Expect = 7.43056e-07
Identity = 26/78 (33.33%), Postives = 44/78 (56.41%), Query Frame = 1
Query:   52 DEHATKAKTLPESTTNENKLILYGLFKQATVGPVNTSRPGMFNMKDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEE 285
D + AK + ++ L+LY L++QATVGP NT +P + +++KW +W+ + EAM + VK L+E+
Sbjct: 26 DGSDSSAKNVISKFPDDTALLLYALYQQATVGPCNTPKPSAWRPVEQSKWKSWQGLGTMPSIEAMRLF---VKILEED 100

Related info for CV090964