DR066977

Information for DR066977

NameDR066977
AccessionID2425
Length218 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_016374 Vco01
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession DR066977
Sequence
TCGGACATCTTTGCAAAAATTATAGCCGCGCGAAAACACACTGGCAAATCAGAGAACGAC
ATGTTGCAGTCCTTCATGGACTCAAAGTACAAAGATGGACGCCAAACTACTGAGTCTGAG
GTCACTGGATTGCTAATTGCCGCTCTCTTTGCTGGGCAGCACACCAAGTTCCATCACCTC
CACCTTGGACCGGGGCCTACCTTCCTTAGTAACAAGAA
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0009055 molecular_function electron carrier activity
GO:0020037 molecular_function heme binding
GO:0005506 molecular_function iron ion binding
GO:0004497 molecular_function monooxygenase activity

KEGG Analysis

Analysis Date: 01-18-2011 (KEGG analysis for Vaccinium corymbosum unigene v1)
K05917 CYP51; cytochrome P450, family 51 (sterol 14-demethylase) [EC:1.14.13.70]

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: DR066977_1_ORF1 CRC64: 215CE89BB9B78645 LENGTH: 72 aa
InterPro
IPR001128
Family
Cytochrome P450
G3DSA:1.10.630.10 [2-56]T 1.4e-06 G3DSA:1.10.630.10 no description no description
PTHR19383 [1-55]T 3.3e-20 PTHR19383 CYTOCHROME P450 CYTOCHROME P450
noIPR
unintegrated
unintegrated
PTHR19383:SF13 [1-55]T 3.3e-20 PTHR19383:SF13 CYTOCHROME P450, SUBFAMILY 51A CYTOCHROME P450, SUBFAMILY 51A

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: DR066977
Best 10 Hits Shown

Match Name E value Identity Description
ppa003821m 1.54e-1878.18%ppa003821m
HSP 1
Score: 87.4261 bits (215), Expect = 1.54001e-18
Identity = 43/55 (78.18%), Postives = 48/55 (87.27%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
S+IFA II +RKH + ENDMLQ F+DSKYK+GR TTESEVTGLLIAALFAGQHT
Sbjct: 294 SEIFASIINSRKHAEQCENDMLQCFIDSKYKNGRPTTESEVTGLLIAALFAGQHT 348

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: DR066977
Best 10 Hits Shown

Match Name E value Identity Description
CP51_WHEAT1.84e-1778.18%
Obtusifoliol 14-alpha demethylase (Fragm...
HSP 1
Score: 87.8113 bits (216), Expect = 1.83794e-17
Identity = 43/55 (78.18%), Postives = 50/55 (90.91%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK +G+SE DMLQ F+DSKYK+GRQTTESEVTGLLIAALFAGQHT
Sbjct: 200 AEIFATIIKSRKASGQSEEDMLQCFIDSKYKNGRQTTESEVTGLLIAALFAGQHT 254

CP51_SORBI2.65e-1674.55%
Obtusifoliol 14-alpha demethylase OS=Sor...
HSP 1
Score: 83.9593 bits (206), Expect = 2.65398e-16
Identity = 41/55 (74.55%), Postives = 48/55 (87.27%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK +G+SE DMLQ F+DSKYK+GR TTE EVTGLLIAALFAGQHT
Sbjct: 239 AEIFATIIKSRKASGQSEEDMLQCFIDSKYKNGRPTTEGEVTGLLIAALFAGQHT 293

CP51A_BOVIN7.00e-0950.00%
Lanosterol 14-alpha demethylase OS=Bos t...
HSP 1
Score: 59.3066 bits (142), Expect = 7.00038e-09
Identity = 27/54 (50.00%), Postives = 38/54 (70.37%), Query Frame = 1
Query:    4 DIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
+IF K I R+ +G+ +D+LQ+ ++S YKDGR T+ EV G+LI L AGQHT
Sbjct: 261 NIFYKAIQKRRESGEKIDDILQTLLESTYKDGRPLTDDEVAGMLIGLLLAGQHT 314

CP51A_PONAB1.19e-0850.00%
Lanosterol 14-alpha demethylase OS=Pongo...
HSP 1
Score: 58.5362 bits (140), Expect = 1.19408e-08
Identity = 27/54 (50.00%), Postives = 37/54 (68.52%), Query Frame = 1
Query:    4 DIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
DIF K I R+ + + +D+LQ+ +D+ YKDGR T+ EV G+LI L AGQHT
Sbjct: 262 DIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHT 315

CP51A_HUMAN1.19e-0850.00%
Lanosterol 14-alpha demethylase OS=Homo ...
HSP 1
Score: 58.5362 bits (140), Expect = 1.19408e-08
Identity = 27/54 (50.00%), Postives = 37/54 (68.52%), Query Frame = 1
Query:    4 DIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
DIF K I R+ + + +D+LQ+ +D+ YKDGR T+ EV G+LI L AGQHT
Sbjct: 262 DIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHT 315

CP51A_PIG2.04e-0850.00%
Lanosterol 14-alpha demethylase OS=Sus s...
HSP 1
Score: 57.7658 bits (138), Expect = 2.0368e-08
Identity = 27/54 (50.00%), Postives = 37/54 (68.52%), Query Frame = 1
Query:    4 DIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
+IF K I R+ + + +D+LQ+ +DS YKDGR T+ EV G+LI L AGQHT
Sbjct: 262 NIFYKAIQKRRQSEEKIDDILQTLLDSTYKDGRPLTDDEVAGMLIGLLLAGQHT 315

CP51A_MOUSE4.54e-0848.15%
Lanosterol 14-alpha demethylase OS=Mus m...
HSP 1
Score: 56.6102 bits (135), Expect = 4.53752e-08
Identity = 26/54 (48.15%), Postives = 37/54 (68.52%), Query Frame = 1
Query:    4 DIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
+IF K I R+ + + D+LQ+ +DS YKDGR T+ E++G+LI L AGQHT
Sbjct: 262 NIFYKAIQKRRLSKEPAEDILQTLLDSTYKDGRPLTDEEISGMLIGLLLAGQHT 315

CP51A_MACFA4.54e-0848.15%
Lanosterol 14-alpha demethylase OS=Macac...
HSP 1
Score: 56.6102 bits (135), Expect = 4.53752e-08
Identity = 26/54 (48.15%), Postives = 37/54 (68.52%), Query Frame = 1
Query:    4 DIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
+IF K I R+ + + +D+LQ+ +D+ YKDGR T+ EV G+LI L AGQHT
Sbjct: 262 NIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHT 315

CP51A_RAT5.93e-0848.15%
Lanosterol 14-alpha demethylase OS=Rattu...
HSP 1
Score: 56.225 bits (134), Expect = 5.92618e-08
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 1
Query:    4 DIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
+IF K I R+ + + D+LQ+ +DS YKDGR T+ E+ G+LI L AGQHT
Sbjct: 262 NIFYKAIQKRRLSKEPAEDILQTLLDSTYKDGRPLTDDEIAGMLIGLLLAGQHT 315

CP51_CUNEL6.55e-0742.86%
Lanosterol 14-alpha demethylase OS=Cunni...
HSP 1
Score: 52.7582 bits (125), Expect = 6.55216e-07
Identity = 24/56 (42.86%), Postives = 36/56 (64.29%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSEN-DMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
+D+++ II RK + N D+LQ+ MD+ YKDG + + G++IA LF GQHT
Sbjct: 246 ADLYSSIIQRRKDEKDNNNADLLQALMDATYKDGTHIPDHHIAGMMIAVLFGGQHT 301

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: DR066977
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0003s160103.49e-1980.00%POPTR_0003s16010.1
HSP 1
Score: 90.1225 bits (222), Expect = 3.4917e-19
Identity = 44/55 (80.00%), Postives = 49/55 (89.09%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK GKSENDMLQ F+DSKYKDGR TTESE+TGLLIAALFAGQHT
Sbjct: 236 AEIFANIINSRKLAGKSENDMLQCFIDSKYKDGRPTTESEITGLLIAALFAGQHT 290

POPTR_0001s129101.73e-1878.18%POPTR_0001s12910.1
HSP 1
Score: 87.8113 bits (216), Expect = 1.73291e-18
Identity = 43/55 (78.18%), Postives = 48/55 (87.27%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK KSENDMLQ F+DSKYKDGR TTESE+TGLLIAALFAGQHT
Sbjct: 236 AEIFANIINSRKLASKSENDMLQCFIDSKYKDGRPTTESEITGLLIAALFAGQHT 290

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: DR066977
Best 10 Hits Shown

Match Name E value Identity Description
D7TFJ6_VITVI1.08e-1888.68%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 96.2857 bits (238), Expect = 1.08311e-18
Identity = 47/53 (88.68%), Postives = 50/53 (94.34%), Query Frame = 1
Query:    7 IFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
IFA IIA+R+ TGKSENDMLQ FMDSKYKDGRQTTE+EVTGLLIAALFAGQHT
Sbjct: 236 IFANIIASRRETGKSENDMLQCFMDSKYKDGRQTTEAEVTGLLIAALFAGQHT 288

Q9SAA9_ARATH1.85e-1883.64%
At1g11680/F25C20_17 OS=Arabidopsis thali...
HSP 1
Score: 95.5153 bits (236), Expect = 1.84751e-18
Identity = 46/55 (83.64%), Postives = 52/55 (94.55%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
S+IFAKII +RK +GK+ENDMLQ F++SKYKDGRQTTESEVTGLLIAALFAGQHT
Sbjct: 238 SEIFAKIIGSRKRSGKTENDMLQCFIESKYKDGRQTTESEVTGLLIAALFAGQHT 292

D7KMH5_ARALY4.12e-1881.82%
CYP51G1 OS=Arabidopsis lyrata subsp. lyr...
HSP 1
Score: 94.3597 bits (233), Expect = 4.11582e-18
Identity = 45/55 (81.82%), Postives = 52/55 (94.55%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IF+KII +RK +GKSENDMLQ F++SKYKDGRQTTESEVTGLLIAALFAGQHT
Sbjct: 238 AEIFSKIIGSRKRSGKSENDMLQCFIESKYKDGRQTTESEVTGLLIAALFAGQHT 292

A0PFU3_PETHY2.67e-1780.00%
Obtusifoliol-14-demethylase OS=Petunia h...
HSP 1
Score: 91.6633 bits (226), Expect = 2.6678e-17
Identity = 44/55 (80.00%), Postives = 50/55 (90.91%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
+ IFA IIA+RK TGK+E+DMLQ F+DSKYKDGR TTESE+TGLLIAALFAGQHT
Sbjct: 236 AQIFANIIASRKRTGKAESDMLQCFIDSKYKDGRPTTESEITGLLIAALFAGQHT 290

Q673E9_SOLCH5.94e-1778.18%
Obtusifoliol 14alpha-demethylase OS=Sola...
HSP 1
Score: 90.5077 bits (223), Expect = 5.94323e-17
Identity = 43/55 (78.18%), Postives = 49/55 (89.09%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK TGK+ENDMLQ F+DSKYKDGR TTE E+TGLLIAALFAGQHT
Sbjct: 235 AEIFANIINSRKRTGKAENDMLQCFIDSKYKDGRPTTEGEITGLLIAALFAGQHT 289

B9RG11_RICCO5.94e-1780.00%
Cytochrome P450, putative OS=Ricinus com...
HSP 1
Score: 90.5077 bits (223), Expect = 5.94323e-17
Identity = 44/55 (80.00%), Postives = 50/55 (90.91%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA IIA+RK GK+ENDMLQ F+DSKYKDGR TTE+EVTGLLIAALFAGQHT
Sbjct: 234 AEIFANIIASRKLAGKTENDMLQCFIDSKYKDGRPTTEAEVTGLLIAALFAGQHT 288

Q8GZV0_TOBAC7.76e-1778.18%
Obtusifoliol-14-demethylase OS=Nicotiana...
HSP 1
Score: 90.1225 bits (222), Expect = 7.7621e-17
Identity = 43/55 (78.18%), Postives = 50/55 (90.91%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK TGK+E+DMLQ F+DSKYKDGR TTESE+TGLLIAALFAGQHT
Sbjct: 235 AEIFANIIDSRKRTGKAESDMLQCFIDSKYKDGRATTESEITGLLIAALFAGQHT 289

B9GZ13_POPTR7.76e-1780.00%
Cytochrome P450 probable obtusifoliol 14...
HSP 1
Score: 90.1225 bits (222), Expect = 7.7621e-17
Identity = 44/55 (80.00%), Postives = 49/55 (89.09%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK GKSENDMLQ F+DSKYKDGR TTESE+TGLLIAALFAGQHT
Sbjct: 236 AEIFANIINSRKLAGKSENDMLQCFIDSKYKDGRPTTESEITGLLIAALFAGQHT 290

B3GS58_GOSHI1.01e-1683.02%
Obtusifoliol-14alpha-demethylase OS=Goss...
HSP 1
Score: 89.7373 bits (221), Expect = 1.01376e-16
Identity = 44/53 (83.02%), Postives = 48/53 (90.57%), Query Frame = 1
Query:    7 IFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
IFA IIA+RK GKSENDMLQ F++SKYKDGR TTE+EVTGLLIAALFAGQHT
Sbjct: 236 IFANIIASRKSAGKSENDMLQCFIESKYKDGRPTTEAEVTGLLIAALFAGQHT 288

Q8GVD5_TOBAC1.73e-1676.36%
Obtusifoliol-14-demethylase OS=Nicotiana...
HSP 1
Score: 88.9669 bits (219), Expect = 1.72922e-16
Identity = 42/55 (76.36%), Postives = 50/55 (90.91%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK TGK+E+DMLQ F+DSKYKDGR TT+SE+TGLLIAALFAGQHT
Sbjct: 235 AEIFANIIDSRKRTGKAESDMLQCFIDSKYKDGRATTDSEITGLLIAALFAGQHT 289

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: DR066977
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010011010012.83e-2188.68%GSVIVT01001101001 assembled CDS
HSP 1
Score: 96.2857 bits (238), Expect = 2.83492e-21
Identity = 47/53 (88.68%), Postives = 50/53 (94.34%), Query Frame = 1
Query:    7 IFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
IFA IIA+R+ TGKSENDMLQ FMDSKYKDGRQTTE+EVTGLLIAALFAGQHT
Sbjct: 236 IFANIIASRRETGKSENDMLQCFMDSKYKDGRQTTEAEVTGLLIAALFAGQHT 288

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: DR066977
Best 10 Hits Shown

Match Name E value Identity Description
AT1G11680.1 7.10e-2183.64%
CYTOCHROME P450 51G1 | chr1:3938925-394...
HSP 1
Score: 95.5153 bits (236), Expect = 7.10224e-21
Identity = 46/55 (83.64%), Postives = 52/55 (94.55%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
S+IFAKII +RK +GK+ENDMLQ F++SKYKDGRQTTESEVTGLLIAALFAGQHT
Sbjct: 238 SEIFAKIIGSRKRSGKTENDMLQCFIESKYKDGRQTTESEVTGLLIAALFAGQHT 292

Related info for DR066977