Please Note: This site will be unavailable Thursday May 1st  due to maintenance and content upgrades. We apologize for the inconvenience. 

DR066977

Information for DR066977

NameDR066977
AccessionID2425
Length218 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_016374 Vco01
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession DR066977
Sequence
TCGGACATCTTTGCAAAAATTATAGCCGCGCGAAAACACACTGGCAAATCAGAGAACGAC
ATGTTGCAGTCCTTCATGGACTCAAAGTACAAAGATGGACGCCAAACTACTGAGTCTGAG
GTCACTGGATTGCTAATTGCCGCTCTCTTTGCTGGGCAGCACACCAAGTTCCATCACCTC
CACCTTGGACCGGGGCCTACCTTCCTTAGTAACAAGAA
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0009055 molecular_function electron carrier activity
GO:0020037 molecular_function heme binding
GO:0005506 molecular_function iron ion binding
GO:0004497 molecular_function monooxygenase activity

KEGG Analysis

Analysis Date: 01-18-2011 (KEGG analysis for Vaccinium corymbosum unigene v1)
K05917 CYP51; cytochrome P450, family 51 (sterol 14-demethylase) [EC:1.14.13.70]

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: DR066977_1_ORF1 CRC64: 215CE89BB9B78645 LENGTH: 72 aa
InterPro
IPR001128
Family
Cytochrome P450
G3DSA:1.10.630.10 [2-56]T 1.4e-06 G3DSA:1.10.630.10 no description no description
PTHR19383 [1-55]T 3.3e-20 PTHR19383 CYTOCHROME P450 CYTOCHROME P450
noIPR
unintegrated
unintegrated
PTHR19383:SF13 [1-55]T 3.3e-20 PTHR19383:SF13 CYTOCHROME P450, SUBFAMILY 51A CYTOCHROME P450, SUBFAMILY 51A

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: DR066977
Best 10 Hits Shown

Match Name E value Identity Description
ppa003821m 1.54e-1878.18%ppa003821m
HSP 1
Score: 87.4261 bits (215), Expect = 1.54001e-18
Identity = 43/55 (78.18%), Postives = 48/55 (87.27%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
S+IFA II +RKH + ENDMLQ F+DSKYK+GR TTESEVTGLLIAALFAGQHT
Sbjct: 294 SEIFASIINSRKHAEQCENDMLQCFIDSKYKNGRPTTESEVTGLLIAALFAGQHT 348

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: DR066977
Best 10 Hits Shown

Match Name E value Identity Description
CP51_WHEAT1.84e-1778.18%
Obtusifoliol 14-alpha demethylase (Fragm...
HSP 1
Score: 87.8113 bits (216), Expect = 1.83794e-17
Identity = 43/55 (78.18%), Postives = 50/55 (90.91%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK +G+SE DMLQ F+DSKYK+GRQTTESEVTGLLIAALFAGQHT
Sbjct: 200 AEIFATIIKSRKASGQSEEDMLQCFIDSKYKNGRQTTESEVTGLLIAALFAGQHT 254

CP51_SORBI2.65e-1674.55%
Obtusifoliol 14-alpha demethylase OS=Sor...
HSP 1
Score: 83.9593 bits (206), Expect = 2.65398e-16
Identity = 41/55 (74.55%), Postives = 48/55 (87.27%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK +G+SE DMLQ F+DSKYK+GR TTE EVTGLLIAALFAGQHT
Sbjct: 239 AEIFATIIKSRKASGQSEEDMLQCFIDSKYKNGRPTTEGEVTGLLIAALFAGQHT 293

CP51A_BOVIN7.00e-0950.00%
Lanosterol 14-alpha demethylase OS=Bos t...
HSP 1
Score: 59.3066 bits (142), Expect = 7.00038e-09
Identity = 27/54 (50.00%), Postives = 38/54 (70.37%), Query Frame = 1
Query:    4 DIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
+IF K I R+ +G+ +D+LQ+ ++S YKDGR T+ EV G+LI L AGQHT
Sbjct: 261 NIFYKAIQKRRESGEKIDDILQTLLESTYKDGRPLTDDEVAGMLIGLLLAGQHT 314

CP51A_PONAB1.19e-0850.00%
Lanosterol 14-alpha demethylase OS=Pongo...
HSP 1
Score: 58.5362 bits (140), Expect = 1.19408e-08
Identity = 27/54 (50.00%), Postives = 37/54 (68.52%), Query Frame = 1
Query:    4 DIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
DIF K I R+ + + +D+LQ+ +D+ YKDGR T+ EV G+LI L AGQHT
Sbjct: 262 DIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHT 315

CP51A_HUMAN1.19e-0850.00%
Lanosterol 14-alpha demethylase OS=Homo ...
HSP 1
Score: 58.5362 bits (140), Expect = 1.19408e-08
Identity = 27/54 (50.00%), Postives = 37/54 (68.52%), Query Frame = 1
Query:    4 DIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
DIF K I R+ + + +D+LQ+ +D+ YKDGR T+ EV G+LI L AGQHT
Sbjct: 262 DIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHT 315

CP51A_PIG2.04e-0850.00%
Lanosterol 14-alpha demethylase OS=Sus s...
HSP 1
Score: 57.7658 bits (138), Expect = 2.0368e-08
Identity = 27/54 (50.00%), Postives = 37/54 (68.52%), Query Frame = 1
Query:    4 DIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
+IF K I R+ + + +D+LQ+ +DS YKDGR T+ EV G+LI L AGQHT
Sbjct: 262 NIFYKAIQKRRQSEEKIDDILQTLLDSTYKDGRPLTDDEVAGMLIGLLLAGQHT 315

CP51A_MOUSE4.54e-0848.15%
Lanosterol 14-alpha demethylase OS=Mus m...
HSP 1
Score: 56.6102 bits (135), Expect = 4.53752e-08
Identity = 26/54 (48.15%), Postives = 37/54 (68.52%), Query Frame = 1
Query:    4 DIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
+IF K I R+ + + D+LQ+ +DS YKDGR T+ E++G+LI L AGQHT
Sbjct: 262 NIFYKAIQKRRLSKEPAEDILQTLLDSTYKDGRPLTDEEISGMLIGLLLAGQHT 315

CP51A_MACFA4.54e-0848.15%
Lanosterol 14-alpha demethylase OS=Macac...
HSP 1
Score: 56.6102 bits (135), Expect = 4.53752e-08
Identity = 26/54 (48.15%), Postives = 37/54 (68.52%), Query Frame = 1
Query:    4 DIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
+IF K I R+ + + +D+LQ+ +D+ YKDGR T+ EV G+LI L AGQHT
Sbjct: 262 NIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHT 315

CP51A_RAT5.93e-0848.15%
Lanosterol 14-alpha demethylase OS=Rattu...
HSP 1
Score: 56.225 bits (134), Expect = 5.92618e-08
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = 1
Query:    4 DIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
+IF K I R+ + + D+LQ+ +DS YKDGR T+ E+ G+LI L AGQHT
Sbjct: 262 NIFYKAIQKRRLSKEPAEDILQTLLDSTYKDGRPLTDDEIAGMLIGLLLAGQHT 315

CP51_CUNEL6.55e-0742.86%
Lanosterol 14-alpha demethylase OS=Cunni...
HSP 1
Score: 52.7582 bits (125), Expect = 6.55216e-07
Identity = 24/56 (42.86%), Postives = 36/56 (64.29%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSEN-DMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
+D+++ II RK + N D+LQ+ MD+ YKDG + + G++IA LF GQHT
Sbjct: 246 ADLYSSIIQRRKDEKDNNNADLLQALMDATYKDGTHIPDHHIAGMMIAVLFGGQHT 301

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: DR066977
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0003s160103.49e-1980.00%POPTR_0003s16010.1
HSP 1
Score: 90.1225 bits (222), Expect = 3.4917e-19
Identity = 44/55 (80.00%), Postives = 49/55 (89.09%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK GKSENDMLQ F+DSKYKDGR TTESE+TGLLIAALFAGQHT
Sbjct: 236 AEIFANIINSRKLAGKSENDMLQCFIDSKYKDGRPTTESEITGLLIAALFAGQHT 290

POPTR_0001s129101.73e-1878.18%POPTR_0001s12910.1
HSP 1
Score: 87.8113 bits (216), Expect = 1.73291e-18
Identity = 43/55 (78.18%), Postives = 48/55 (87.27%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK KSENDMLQ F+DSKYKDGR TTESE+TGLLIAALFAGQHT
Sbjct: 236 AEIFANIINSRKLASKSENDMLQCFIDSKYKDGRPTTESEITGLLIAALFAGQHT 290

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: DR066977
Best 10 Hits Shown

Match Name E value Identity Description
D7TFJ6_VITVI1.08e-1888.68%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 96.2857 bits (238), Expect = 1.08311e-18
Identity = 47/53 (88.68%), Postives = 50/53 (94.34%), Query Frame = 1
Query:    7 IFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
IFA IIA+R+ TGKSENDMLQ FMDSKYKDGRQTTE+EVTGLLIAALFAGQHT
Sbjct: 236 IFANIIASRRETGKSENDMLQCFMDSKYKDGRQTTEAEVTGLLIAALFAGQHT 288

Q9SAA9_ARATH1.85e-1883.64%
At1g11680/F25C20_17 OS=Arabidopsis thali...
HSP 1
Score: 95.5153 bits (236), Expect = 1.84751e-18
Identity = 46/55 (83.64%), Postives = 52/55 (94.55%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
S+IFAKII +RK +GK+ENDMLQ F++SKYKDGRQTTESEVTGLLIAALFAGQHT
Sbjct: 238 SEIFAKIIGSRKRSGKTENDMLQCFIESKYKDGRQTTESEVTGLLIAALFAGQHT 292

D7KMH5_ARALY4.12e-1881.82%
CYP51G1 OS=Arabidopsis lyrata subsp. lyr...
HSP 1
Score: 94.3597 bits (233), Expect = 4.11582e-18
Identity = 45/55 (81.82%), Postives = 52/55 (94.55%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IF+KII +RK +GKSENDMLQ F++SKYKDGRQTTESEVTGLLIAALFAGQHT
Sbjct: 238 AEIFSKIIGSRKRSGKSENDMLQCFIESKYKDGRQTTESEVTGLLIAALFAGQHT 292

A0PFU3_PETHY2.67e-1780.00%
Obtusifoliol-14-demethylase OS=Petunia h...
HSP 1
Score: 91.6633 bits (226), Expect = 2.6678e-17
Identity = 44/55 (80.00%), Postives = 50/55 (90.91%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
+ IFA IIA+RK TGK+E+DMLQ F+DSKYKDGR TTESE+TGLLIAALFAGQHT
Sbjct: 236 AQIFANIIASRKRTGKAESDMLQCFIDSKYKDGRPTTESEITGLLIAALFAGQHT 290

Q673E9_SOLCH5.94e-1778.18%
Obtusifoliol 14alpha-demethylase OS=Sola...
HSP 1
Score: 90.5077 bits (223), Expect = 5.94323e-17
Identity = 43/55 (78.18%), Postives = 49/55 (89.09%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK TGK+ENDMLQ F+DSKYKDGR TTE E+TGLLIAALFAGQHT
Sbjct: 235 AEIFANIINSRKRTGKAENDMLQCFIDSKYKDGRPTTEGEITGLLIAALFAGQHT 289

B9RG11_RICCO5.94e-1780.00%
Cytochrome P450, putative OS=Ricinus com...
HSP 1
Score: 90.5077 bits (223), Expect = 5.94323e-17
Identity = 44/55 (80.00%), Postives = 50/55 (90.91%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA IIA+RK GK+ENDMLQ F+DSKYKDGR TTE+EVTGLLIAALFAGQHT
Sbjct: 234 AEIFANIIASRKLAGKTENDMLQCFIDSKYKDGRPTTEAEVTGLLIAALFAGQHT 288

Q8GZV0_TOBAC7.76e-1778.18%
Obtusifoliol-14-demethylase OS=Nicotiana...
HSP 1
Score: 90.1225 bits (222), Expect = 7.7621e-17
Identity = 43/55 (78.18%), Postives = 50/55 (90.91%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK TGK+E+DMLQ F+DSKYKDGR TTESE+TGLLIAALFAGQHT
Sbjct: 235 AEIFANIIDSRKRTGKAESDMLQCFIDSKYKDGRATTESEITGLLIAALFAGQHT 289

B9GZ13_POPTR7.76e-1780.00%
Cytochrome P450 probable obtusifoliol 14...
HSP 1
Score: 90.1225 bits (222), Expect = 7.7621e-17
Identity = 44/55 (80.00%), Postives = 49/55 (89.09%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK GKSENDMLQ F+DSKYKDGR TTESE+TGLLIAALFAGQHT
Sbjct: 236 AEIFANIINSRKLAGKSENDMLQCFIDSKYKDGRPTTESEITGLLIAALFAGQHT 290

B3GS58_GOSHI1.01e-1683.02%
Obtusifoliol-14alpha-demethylase OS=Goss...
HSP 1
Score: 89.7373 bits (221), Expect = 1.01376e-16
Identity = 44/53 (83.02%), Postives = 48/53 (90.57%), Query Frame = 1
Query:    7 IFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
IFA IIA+RK GKSENDMLQ F++SKYKDGR TTE+EVTGLLIAALFAGQHT
Sbjct: 236 IFANIIASRKSAGKSENDMLQCFIESKYKDGRPTTEAEVTGLLIAALFAGQHT 288

Q8GVD5_TOBAC1.73e-1676.36%
Obtusifoliol-14-demethylase OS=Nicotiana...
HSP 1
Score: 88.9669 bits (219), Expect = 1.72922e-16
Identity = 42/55 (76.36%), Postives = 50/55 (90.91%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
++IFA II +RK TGK+E+DMLQ F+DSKYKDGR TT+SE+TGLLIAALFAGQHT
Sbjct: 235 AEIFANIIDSRKRTGKAESDMLQCFIDSKYKDGRATTDSEITGLLIAALFAGQHT 289

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: DR066977
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010011010012.83e-2188.68%GSVIVT01001101001 assembled CDS
HSP 1
Score: 96.2857 bits (238), Expect = 2.83492e-21
Identity = 47/53 (88.68%), Postives = 50/53 (94.34%), Query Frame = 1
Query:    7 IFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
IFA IIA+R+ TGKSENDMLQ FMDSKYKDGRQTTE+EVTGLLIAALFAGQHT
Sbjct: 236 IFANIIASRRETGKSENDMLQCFMDSKYKDGRQTTEAEVTGLLIAALFAGQHT 288

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: DR066977
Best 10 Hits Shown

Match Name E value Identity Description
AT1G11680.1 7.10e-2183.64%
CYTOCHROME P450 51G1 | chr1:3938925-394...
HSP 1
Score: 95.5153 bits (236), Expect = 7.10224e-21
Identity = 46/55 (83.64%), Postives = 52/55 (94.55%), Query Frame = 1
Query:    1 SDIFAKIIAARKHTGKSENDMLQSFMDSKYKDGRQTTESEVTGLLIAALFAGQHT 165
S+IFAKII +RK +GK+ENDMLQ F++SKYKDGRQTTESEVTGLLIAALFAGQHT
Sbjct: 238 SEIFAKIIGSRKRSGKTENDMLQCFIESKYKDGRQTTESEVTGLLIAALFAGQHT 292

Related info for DR066977