DW043483

Information for DW043483

NameDW043483
AccessionID2552
Length710 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_018810 Subtracted cDNA library of Vaccinium corymbosum
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession DW043483
Sequence
ACCATTGAAAGTTTTATTCATTATGTACAAAATATAACTAGTAGTACATGTTTTTTTTGG
GTACAACTACAAGTGTAACACCATCTTGATAAATTCCTAATTTTCATACAGAGTGGACCT
ACACAAGGGCCCCACCTTTAGACAAACTCGGTGAAGGCCAGTGCAAATAAACCCACCATA
GCAAATCTCCCATTCCACATCTCAGCATCAGCGCTAAAGAACTCTTTTGACTTTGACTCC
ACACTCACTCCTTTGAATTGAGGAATCAAAGATGCTACGGAAAGCACACCGGAAGTCAGC
ACAAACCACGGGGATCCCACCATTGGGATATCTGAGATAAACCCATTCCTGGACCATTGG
TATAGTTTCCACGGGCCATTGTCTGGCCACGAAAGACCGAATTCATNGCCGCAACTCTGG
CCGGTTGGATTTCTCCTCCGCGGTGCCTAGACCCACCTAAATTGCGAAACACCGGTCGAA
AAGAAAATTCGGTGGCTGGGCCTCCGCCCTTTTTGGGGACCACGCTGACCGGGAGATNTC
TACCTTCCCTTTTTTTTGAACCGCCCTTGGGCCCTTGCCCCCGCGCACTAACCCCCGGCT
TATAAGACCTCCCTCTCTACTTGGGACCGGGGGCGCCTTTTATACCACCCCCCCAGGGGA
GACTTCTTTTTGGGTTTTTTCAAGTTTTCCCAACCCCACCCGCCGCGCGC
Download sequence in fasta format

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: DW043483_6_ORF2 CRC64: 66E938001593CF0F LENGTH: 102 aa
InterPro
IPR022796
Family
Chlorophyll A-B binding protein
PF00504 [66-100]T 3e-05 PF00504 Chloroa_b-bind Chloroa_b-bind
noIPR
unintegrated
unintegrated
PTHR14154 [34-102]T 1.8e-21 PTHR14154 UPF0041 BRAIN PROTEIN 44-RELATED UPF0041 BRAIN PROTEIN 44-RELATED
PTHR14154:SF1 [34-102]T 1.8e-21 PTHR14154:SF1 EARLY LIGHT-INDUCED PROTEIN EARLY LIGHT-INDUCED PROTEIN
SSF103511 [2-102]T 8.9e-07 SSF103511 Chlorophyll a-b binding protein Chlorophyll a-b binding protein

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: DW043483
Best 10 Hits Shown

Match Name E value Identity Description
ppa011739m 8.90e-1566.10%ppa011739m
HSP 1
Score: 77.0258 bits (188), Expect = 8.89845e-15
Identity = 39/59 (66.10%), Postives = 47/59 (79.66%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G F+ TS +LSVAS+IP FKGVSVESKS ++DAE+WNGR AM+GL ALAFTE+V
Sbjct: 134 GVSLFLATSILLSVASVIPLFKGVSVESKSDGIMTSDAELWNGRLAMLGLVALAFTEYV 192

ppa011747m 1.98e-1466.10%ppa011747m
HSP 1
Score: 75.8702 bits (185), Expect = 1.98237e-14
Identity = 39/59 (66.10%), Postives = 47/59 (79.66%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G F+ TS +LSVASLIP F+GVSVESKS ++DAE+WNGR AM+GL ALAFTE+V
Sbjct: 134 GVSLFLGTSILLSVASLIPLFRGVSVESKSDGIMTSDAELWNGRLAMLGLVALAFTEYV 192

ppa026587m 1.28e-1364.41%ppa026587m
HSP 1
Score: 73.1738 bits (178), Expect = 1.28493e-13
Identity = 38/59 (64.41%), Postives = 46/59 (77.97%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G FV TS +LSVASL+P FKGVSVESKS+ ++DAE+ NGR AM+GL AL FTE+V
Sbjct: 125 GVSLFVATSILLSVASLVPLFKGVSVESKSEGIMTSDAELLNGRLAMLGLVALVFTEYV 183

ppa014920m 1.28e-1367.80%ppa014920m
HSP 1
Score: 73.1738 bits (178), Expect = 1.28493e-13
Identity = 40/59 (67.80%), Postives = 46/59 (77.97%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G FV TS +LSVASLIP FKGVSVESKS ++DAE+ NGR AM+GL ALAFTE+V
Sbjct: 125 GFSLFVGTSILLSVASLIPLFKGVSVESKSDGIMTSDAELLNGRLAMLGLVALAFTEYV 183

ppa011907m 2.19e-1364.41%ppa011907m
HSP 1
Score: 72.4034 bits (176), Expect = 2.19176e-13
Identity = 38/59 (64.41%), Postives = 45/59 (76.27%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G FV TS +LSVASL+P FKGVSVESKS ++DAE+ NGR AM+GL AL FTE+V
Sbjct: 127 GVSLFVATSILLSVASLVPLFKGVSVESKSDGIMTSDAELLNGRLAMLGLVALVFTEYV 185

ppa027213m 3.62e-0869.44%ppa027213m
HSP 1
Score: 55.0694 bits (131), Expect = 3.62111e-08
Identity = 25/36 (69.44%), Postives = 31/36 (86.11%), Query Frame = -1
Query:  141 VSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 248
VSVESKSK ++DAE+WNGR AM+GL A+AFTE+V
Sbjct: 85 VSVESKSKGVMTSDAELWNGRLAMLGLVAMAFTEYV 120

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: DW043483
Best 10 Hits Shown

Match Name E value Identity Description
ELI_PEA8.94e-1671.19%
Early light-induced protein, chloroplast...
HSP 1
Score: 83.9593 bits (206), Expect = 8.94322e-16
Identity = 42/59 (71.19%), Postives = 48/59 (81.36%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G WF+ TS +LS+ASLIP F+GVSVESKSK S+DAE WNGR AM+GL ALAFTEFV
Sbjct: 132 GVAWFLGTSVLLSLASLIPFFQGVSVESKSKSIMSSDAEFWNGRIAMLGLVALAFTEFV 190

ELI5_HORVU4.44e-1566.10%
High molecular mass early light-inducibl...
HSP 1
Score: 81.6481 bits (200), Expect = 4.43848e-15
Identity = 39/59 (66.10%), Postives = 47/59 (79.66%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G WF+ T+GV SVASL+P +G SVESKS +SADAE+WNGRFAM+GL ALA TEF+
Sbjct: 165 GLAWFLATAGVFSVASLLPLLQGQSVESKSSGIWSADAELWNGRFAMLGLVALAATEFI 223

DS22_CRAPL5.80e-1557.58%
Desiccation stress protein DSP-22, chlor...
HSP 1
Score: 81.2629 bits (199), Expect = 5.79683e-15
Identity = 38/66 (57.58%), Postives = 54/66 (81.82%), Query Frame = -1
Query:  120 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV*RWGPCV 317
G WF+LTS VL +A+LIP ++G+S E+K+ F+++DAE+WNGRFAM+GL ALAFTE+V + GP +
Sbjct: 133 GVMWFLLTSAVLVLATLIPIYRGLSPEAKNNGFWNSDAEIWNGRFAMIGLVALAFTEYV-KGGPLI 197

ELI9_HORVU6.63e-1152.54%
Low molecular mass early light-inducible...
HSP 1
Score: 67.781 bits (164), Expect = 6.63243e-11
Identity = 31/59 (52.54%), Postives = 41/59 (69.49%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G WF T VLS+ASL+P +G S E ++ +A+AE+WNGRFAM+GL ALA TE +
Sbjct: 106 GQAWFAYTVAVLSMASLVPLLQGESAEGRAGAIMNANAELWNGRFAMLGLVALAATEII 164

ELI6_HORVU8.66e-1150.85%
Low molecular mass early light-inducible...
HSP 1
Score: 67.3958 bits (163), Expect = 8.66222e-11
Identity = 30/59 (50.85%), Postives = 41/59 (69.49%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G WF T +LS+ASL+P +G S E ++ +A+AE+WNGRFAM+GL ALA TE +
Sbjct: 101 GQAWFAYTVAMLSMASLVPLLQGESAEGRAGAIMNANAELWNGRFAMIGLVALAATEII 159

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: DW043483
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0008s158002.08e-1769.23%POPTR_0008s15800.3
HSP 1
Score: 86.2705 bits (212), Expect = 2.07885e-17
Identity = 45/65 (69.23%), Postives = 50/65 (76.92%), Query Frame = -1
Query:  141 SDIPMVGSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 335
S I G WFV TS +LSVASL+P FKGVS ESKS ++DAEMWNGRFAM+GL ALAFTEFV
Sbjct: 20 SQISNGGVSWFVGTSILLSVASLVPLFKGVSAESKSDGVMTSDAEMWNGRFAMLGLVALAFTEFV 84

POPTR_0008s158002.08e-1769.23%POPTR_0008s15800.2
HSP 1
Score: 86.2705 bits (212), Expect = 2.07885e-17
Identity = 45/65 (69.23%), Postives = 50/65 (76.92%), Query Frame = -1
Query:  141 SDIPMVGSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 335
S I G WFV TS +LSVASL+P FKGVS ESKS ++DAEMWNGRFAM+GL ALAFTEFV
Sbjct: 20 SQISNGGVSWFVGTSILLSVASLVPLFKGVSAESKSDGVMTSDAEMWNGRFAMLGLVALAFTEFV 84

POPTR_0008s158002.08e-1769.23%POPTR_0008s15800.1
HSP 1
Score: 86.2705 bits (212), Expect = 2.07885e-17
Identity = 45/65 (69.23%), Postives = 50/65 (76.92%), Query Frame = -1
Query:  141 SDIPMVGSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 335
S I G WFV TS +LSVASL+P FKGVS ESKS ++DAEMWNGRFAM+GL ALAFTEFV
Sbjct: 112 SQISNGGVSWFVGTSILLSVASLVPLFKGVSAESKSDGVMTSDAEMWNGRFAMLGLVALAFTEFV 176

POPTR_0008s157601.35e-1671.19%POPTR_0008s15760.1
HSP 1
Score: 83.5741 bits (205), Expect = 1.34747e-16
Identity = 42/59 (71.19%), Postives = 48/59 (81.36%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G WFV TS +LSVASLIP FKGVS ESKS ++DAEMWNGRFAM+GL ALA+TE+V
Sbjct: 118 GVSWFVGTSILLSVASLIPLFKGVSAESKSDGVMTSDAEMWNGRFAMLGLVALAYTEYV 176

POPTR_2515s002001.76e-1669.49%POPTR_2515s00200.1
HSP 1
Score: 83.1889 bits (204), Expect = 1.75986e-16
Identity = 41/59 (69.49%), Postives = 49/59 (83.05%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G WF+ TS +LSVASLIP FKGVS ESKS+ ++DAEMWNGRFAM+GL ALA+TE+V
Sbjct: 4 GVSWFLGTSILLSVASLIPLFKGVSAESKSEGVMTSDAEMWNGRFAMLGLVALAYTEYV 62

POPTR_0008s157801.76e-1667.69%POPTR_0008s15780.1
HSP 1
Score: 83.1889 bits (204), Expect = 1.75986e-16
Identity = 44/65 (67.69%), Postives = 50/65 (76.92%), Query Frame = -1
Query:  141 SDIPMVGSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 335
S I G WFV TS +LSVASLIP FKGVS ESKS+ ++DAEMWNGRFAM+GL ALA TE+V
Sbjct: 112 SQISNGGVSWFVGTSILLSVASLIPLFKGVSAESKSEGVMTSDAEMWNGRFAMLGLVALACTEYV 176

POPTR_0008s157703.00e-1667.69%POPTR_0008s15770.1
HSP 1
Score: 82.4185 bits (202), Expect = 3.00186e-16
Identity = 44/65 (67.69%), Postives = 49/65 (75.38%), Query Frame = -1
Query:  141 SDIPMVGSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 335
S I G WFV TS +LSVASLIP FKGVS ESKS ++DAEMWNGRFAM+GL ALA TE+V
Sbjct: 112 SQISNGGVSWFVGTSILLSVASLIPLFKGVSAESKSDGVMTSDAEMWNGRFAMLGLVALACTEYV 176

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: DW043483
Best 10 Hits Shown

Match Name E value Identity Description
B2BJD6_RHOCT1.80e-1981.36%
Early light-induced protein 7 OS=Rhodode...
HSP 1
Score: 100.138 bits (248), Expect = 1.80469e-19
Identity = 48/59 (81.36%), Postives = 54/59 (91.53%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G PWFVLT+GVLSVASLIP F GV+VESKS+ F+S+DAEMWNGRFAM+GL ALAFTEFV
Sbjct: 129 GIPWFVLTTGVLSVASLIPLFSGVTVESKSRPFWSSDAEMWNGRFAMLGLVALAFTEFV 187

B2BJD5_RHOCT9.90e-1879.31%
Early light-induced protein 6 OS=Rhodode...
HSP 1
Score: 94.3597 bits (233), Expect = 9.90264e-18
Identity = 46/58 (79.31%), Postives = 51/58 (87.93%), Query Frame = -1
Query:  144 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEF 317
G PWF+LT+GVLSVASLIP GVSVESKSK F+S+DAEMWNGRFAM+GL ALA TEF
Sbjct: 117 GIPWFLLTTGVLSVASLIPLSNGVSVESKSKPFWSSDAEMWNGRFAMLGLVALALTEF 174

P93169_SOYBN2.21e-1767.65%
Early light-induced protein OS=Glycine m...
HSP 1
Score: 93.2041 bits (230), Expect = 2.20608e-17
Identity = 46/68 (67.65%), Postives = 55/68 (80.88%), Query Frame = -1
Query:  141 GFISDIPMVGSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 344
G + I G PWF+ TS VL++ASLIP F+GVSVESKSK F S+DAE+WNGRFAM+GL ALAFTE+V
Sbjct: 119 GVLEQISNGGIPWFLGTSVVLTLASLIPLFQGVSVESKSKGFMSSDAELWNGRFAMLGLIALAFTEYV 186

C6SXC5_SOYBN2.21e-1767.65%
Putative uncharacterized protein OS=Glyc...
HSP 1
Score: 93.2041 bits (230), Expect = 2.20608e-17
Identity = 46/68 (67.65%), Postives = 55/68 (80.88%), Query Frame = -1
Query:  141 GFISDIPMVGSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 344
G + I G PWF+ TS VL++ASLIP F+GVSVESKSK F S+DAE+WNGRFAM+GL ALAFTE+V
Sbjct: 119 GVLEQISNGGIPWFLGTSVVLTLASLIPLFQGVSVESKSKGFMSSDAELWNGRFAMLGLIALAFTEYV 186

Q850G4_ARAHY8.38e-1769.70%
Putative early light induced protein (Fr...
HSP 1
Score: 91.2781 bits (225), Expect = 8.38309e-17
Identity = 46/66 (69.70%), Postives = 54/66 (81.82%), Query Frame = -1
Query:  141 ISDIPMVGSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 338
+S I G PWF+ TS VLS+ASLIP F+GVSVESKS F S+DAE+WNGRFAM+GL ALAFTE+V
Sbjct: 121 LSQISNGGIPWFLGTSVVLSLASLIPLFQGVSVESKSGGFMSSDAELWNGRFAMLGLIALAFTEYV 186

D7T741_VITVI8.38e-1762.50%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 91.2781 bits (225), Expect = 8.38309e-17
Identity = 45/72 (62.50%), Postives = 54/72 (75.00%), Query Frame = -1
Query:  141 WSRNGFISDIPMVGSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 356
W + I G PWF+ T+ VLS+ASLIP FKGVSVESKSK ++DAEMWNGRFAM+GL ALAFTE++
Sbjct: 108 WKGEDVFAQISNGGIPWFLGTAVVLSLASLIPLFKGVSVESKSKGLMTSDAEMWNGRFAMLGLVALAFTEYL 179

D6QST4_VITVI8.38e-1762.50%
Chloroplast ELIP early light-induced pro...
HSP 1
Score: 91.2781 bits (225), Expect = 8.38309e-17
Identity = 45/72 (62.50%), Postives = 54/72 (75.00%), Query Frame = -1
Query:  141 WSRNGFISDIPMVGSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 356
W + I G PWF+ T+ VLS+ASLIP FKGVSVESKSK ++DAEMWNGRFAM+GL ALAFTE++
Sbjct: 122 WKGEDVFAQISNGGIPWFLGTAVVLSLASLIPLFKGVSVESKSKGLMTSDAEMWNGRFAMLGLVALAFTEYL 193

B6V6N2_9CONI1.09e-1657.69%
Putative early light-induced protein (Fr...
HSP 1
Score: 90.8929 bits (224), Expect = 1.09487e-16
Identity = 45/78 (57.69%), Postives = 57/78 (73.08%), Query Frame = -1
Query:  120 SRNGFISDIPMVGSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV*RWGPCV 353
S +S + G PWFVLT+G+L+ ASL+P KG+S ESKS+ FS+ AEMWNGRFAM+GL ALA TE+V + GP V
Sbjct: 45 SGRDLLSQVNSGGLPWFVLTAGLLTAASLVPLSKGISTESKSQPIFSSSAEMWNGRFAMLGLLALALTEYV-KGGPLV 121

B2BJD4_RHOCT1.09e-1677.97%
Early light-induced protein 5 OS=Rhodode...
HSP 1
Score: 90.8929 bits (224), Expect = 1.09487e-16
Identity = 46/59 (77.97%), Postives = 51/59 (86.44%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G PWF+LT+GVLSVASLIP GVSVESKSK F+S+DAEM NGRFAM+GL ALA TEFV
Sbjct: 112 GIPWFLLTTGVLSVASLIPLSNGVSVESKSKPFWSSDAEMLNGRFAMLGLVALALTEFV 170

C9E439_CAMSI2.44e-1672.88%
Putative early light induced protein 2 O...
HSP 1
Score: 89.7373 bits (221), Expect = 2.43911e-16
Identity = 43/59 (72.88%), Postives = 51/59 (86.44%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G PWFV TS VL++ASL+P FKGVSVES+S+ S+DAE+WNGRFAM+GL ALAFTEFV
Sbjct: 111 GVPWFVGTSIVLTLASLVPLFKGVSVESRSERIMSSDAELWNGRFAMLGLVALAFTEFV 169

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: DW043483
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010180440013.89e-1962.50%GSVIVT01018044001 assembled CDS
HSP 1
Score: 91.2781 bits (225), Expect = 3.89124e-19
Identity = 45/72 (62.50%), Postives = 54/72 (75.00%), Query Frame = -1
Query:  141 WSRNGFISDIPMVGSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 356
W + I G PWF+ T+ VLS+ASLIP FKGVSVESKSK ++DAEMWNGRFAM+GL ALAFTE++
Sbjct: 108 WKGEDVFAQISNGGIPWFLGTAVVLSLASLIPLFKGVSVESKSKGLMTSDAEMWNGRFAMLGLVALAFTEYL 179

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: DW043483
Best 10 Hits Shown

Match Name E value Identity Description
AT3G22840.1 2.39e-1766.10%
Chlorophyll A-B binding family protein ...
HSP 1
Score: 85.8853 bits (211), Expect = 2.38829e-17
Identity = 39/59 (66.10%), Postives = 50/59 (84.75%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G WF+ T+ +L++ASL+P FKG+SVESKSK ++DAE+WNGRFAM+GL ALAFTEFV
Sbjct: 131 GVSWFLGTTAILTLASLVPLFKGISVESKSKGIMTSDAELWNGRFAMLGLVALAFTEFV 189

AT4G14690.1 1.00e-1559.32%
Chlorophyll A-B binding family protein ...
HSP 1
Score: 80.4925 bits (197), Expect = 1.00341e-15
Identity = 35/59 (59.32%), Postives = 49/59 (83.05%), Query Frame = -1
Query:  141 GSPWFVLTSGVLSVASLIPQFKGVSVESKSKEFFSADAEMWNGRFAMVGLFALAFTEFV 317
G WF+ T+ +L++AS++P FKG+ E+KSK F ++DAE+WNGRFAM+GL ALAFTE+V
Sbjct: 129 GVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAMLGLVALAFTEYV 187

Related info for DW043483