Please Note: This site will be unavailable Thursday May 1st  due to maintenance and content upgrades. We apologize for the inconvenience. 

CF810606

Information for CF810606

NameCF810606
AccessionID2584
Length352 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014530 cDNA cold acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CF810606
Sequence
GTTTTTGTCCTGATATCATTTGGTTGGTCAACGGCGAGGAAAATTAGGGAAGTTGGTGTG
AACCTGGTTCTCCAGGGTTTACCTTCTTTGTTTTATTACCAAGAGTACAGCTTGAGTTTG
GACAACCCAGATTCATTTCAGTTCGGACATTGTTGAACTGAAATCCTCACATGCACCTGT
TTATTTATTGGTATGGATTTCAATTTGGTCAGCAGTCTTCTAATGGATTGTGTTTTGGTG
AGCAGGTAATTGCTGGTTTGTGGGTTCTATCAATCTTGGGAGGTTGTTGCAGTTTCTTGA
CATTGTTCTACATANCTTTCGTACTGCTACACACGGNGCCCGTAATATATGA
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0005783 cellular_component endoplasmic reticulum

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CF810606_3_ORF2 CRC64: 27F40352575441FA LENGTH: 63 aa
InterPro
IPR003388
Family
Reticulon
PTHR10994 [28-63]T 2.7e-09 PTHR10994 RETICULON/NOGO RETICULON/NOGO
PF02453 [28-63]T 6.4e-10 PF02453 Reticulon Reticulon
PS50845 [28-63]T 11.573 PS50845 RETICULON RETICULON
noIPR
unintegrated
unintegrated
PTHR10994:SF27 [28-63]T 2.7e-09 PTHR10994:SF27 RETICULON-RELATED (PLANT) RETICULON-RELATED (PLANT)

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CF810606
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0002s166901.74e-1077.14%POPTR_0002s16690.1
HSP 1
Score: 61.2326 bits (147), Expect = 1.74475e-10
Identity = 27/35 (77.14%), Postives = 30/35 (85.71%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
+IAGLWVLSI+G C FLTLFYI FVLLHT PV+Y
Sbjct: 174 IIAGLWVLSIVGSSCHFLTLFYICFVLLHTVPVLY 208

POPTR_0014s086902.98e-1077.14%POPTR_0014s08690.1
HSP 1
Score: 60.4622 bits (145), Expect = 2.97609e-10
Identity = 27/35 (77.14%), Postives = 30/35 (85.71%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLWV+SI+G C FLTLFYI FVLLHT PV+Y
Sbjct: 174 VIAGLWVMSIVGSWCHFLTLFYICFVLLHTVPVLY 208

POPTR_0001s100403.89e-1077.14%POPTR_0001s10040.1
HSP 1
Score: 60.077 bits (144), Expect = 3.8869e-10
Identity = 27/35 (77.14%), Postives = 30/35 (85.71%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLWVLSI+G C+F+TLFYI FVLLHT PV Y
Sbjct: 176 VIAGLWVLSIVGSWCNFVTLFYIAFVLLHTVPVFY 210

POPTR_0003s133408.66e-1077.14%POPTR_0003s13340.1
HSP 1
Score: 58.9214 bits (141), Expect = 8.65911e-10
Identity = 27/35 (77.14%), Postives = 30/35 (85.71%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLWVLSI+G C+FLTLFYI FVLL+T PV Y
Sbjct: 172 VIAGLWVLSIVGSWCNFLTLFYIAFVLLYTVPVFY 206

POPTR_0015s057101.48e-0974.29%POPTR_0015s05710.4
HSP 1
Score: 58.151 bits (139), Expect = 1.47702e-09
Identity = 26/35 (74.29%), Postives = 30/35 (85.71%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGL VLS++G CC+FLTL YI FVLLHT PV+Y
Sbjct: 176 VIAGLLVLSLVGSCCNFLTLLYISFVLLHTVPVLY 210

POPTR_0015s057101.48e-0974.29%POPTR_0015s05710.1
HSP 1
Score: 58.151 bits (139), Expect = 1.47702e-09
Identity = 26/35 (74.29%), Postives = 30/35 (85.71%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGL VLS++G CC+FLTL YI FVLLHT PV+Y
Sbjct: 185 VIAGLLVLSLVGSCCNFLTLLYISFVLLHTVPVLY 219

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CF810606
Best 10 Hits Shown

Match Name E value Identity Description
ppa008259m 6.79e-1182.86%ppa008259m
HSP 1
Score: 62.003 bits (149), Expect = 6.79451e-11
Identity = 29/35 (82.86%), Postives = 31/35 (88.57%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLWVLSI+G C+FLTLFYI FVLLHT PVIY
Sbjct: 263 VIAGLWVLSIVGTWCNFLTLFYISFVLLHTVPVIY 297

ppa010065m 3.16e-0871.43%ppa010065m
HSP 1
Score: 53.1434 bits (126), Expect = 3.15617e-08
Identity = 25/35 (71.43%), Postives = 29/35 (82.86%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIA LW+LS++G +FLTLFYI FVLLHT PVIY
Sbjct: 187 VIAILWILSVVGKWFNFLTLFYITFVLLHTLPVIY 221

ppa010481m 5.95e-0754.29%ppa010481m
HSP 1
Score: 48.9062 bits (115), Expect = 5.95228e-07
Identity = 19/35 (54.29%), Postives = 26/35 (74.29%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
V+A LWV +++G C+FLT+ YI FV HT PV+Y
Sbjct: 170 VVASLWVAAVIGSWCNFLTVLYIGFVAAHTLPVLY 204

ppa010244m 7.77e-0771.43%ppa010244m
HSP 1
Score: 48.521 bits (114), Expect = 7.77391e-07
Identity = 25/35 (71.43%), Postives = 26/35 (74.29%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLWVLSILG +FLTL YI VLL T PV Y
Sbjct: 180 VIAGLWVLSILGKWYNFLTLVYIVVVLLFTLPVFY 214

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CF810606
Best 10 Hits Shown

Match Name E value Identity Description
RTNLB_ARATH2.32e-0776.47%
Reticulon-like protein B2 OS=Arabidopsis...
HSP 1
Score: 54.299 bits (129), Expect = 2.31898e-07
Identity = 26/34 (76.47%), Postives = 27/34 (79.41%), Query Frame = 3
Query:  249 IAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
IAGLWVLSILGGC SFLTL YI VLL T P+ Y
Sbjct: 194 IAGLWVLSILGGCYSFLTLAYIALVLLFTVPLFY 227

RTNLD_ARATH3.03e-0771.43%
Reticulon-like protein B4 OS=Arabidopsis...
HSP 1
Score: 53.9138 bits (128), Expect = 3.02868e-07
Identity = 25/35 (71.43%), Postives = 28/35 (80.00%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLWVLSI+G C +FLTLFY VLL T PV+Y
Sbjct: 176 VIAGLWVLSIIGSCYNFLTLFYTATVLLFTIPVLY 210

RTNLA_ARATH6.75e-0773.53%
Reticulon-like protein B1 OS=Arabidopsis...
HSP 1
Score: 52.7582 bits (125), Expect = 6.7472e-07
Identity = 25/34 (73.53%), Postives = 27/34 (79.41%), Query Frame = 3
Query:  249 IAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
IAGLWVLSILGGC +FLTL YI VLL T P+ Y
Sbjct: 198 IAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAY 231

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CF810606
Best 10 Hits Shown

Match Name E value Identity Description
D7UCH9_VITVI4.02e-1085.71%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 67.781 bits (164), Expect = 4.02136e-10
Identity = 30/35 (85.71%), Postives = 32/35 (91.43%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
+IAGLWVLSILG CC+FLTLFYI FVLLHT PVIY
Sbjct: 177 IIAGLWVLSILGSCCNFLTLFYITFVLLHTVPVIY 211

B3TLN1_ELAGV2.00e-0982.86%
24 kDa seed maturation protein OS=Elaeis...
HSP 1
Score: 65.4698 bits (158), Expect = 1.99578e-09
Identity = 29/35 (82.86%), Postives = 31/35 (88.57%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLWVLSILG CC+FLTLFYI FV LHT PV+Y
Sbjct: 177 VIAGLWVLSILGSCCNFLTLFYILFVTLHTVPVLY 211

Q2PYX0_SOLTU9.90e-0982.86%
Putative 24 kDa seed maturation protein-...
HSP 1
Score: 63.1586 bits (152), Expect = 9.90494e-09
Identity = 29/35 (82.86%), Postives = 31/35 (88.57%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLWVLSILG C +FLTLFYI FVLLHT PV+Y
Sbjct: 177 VIAGLWVLSILGNCWNFLTLFYICFVLLHTVPVLY 211

B3TLV6_ELAGV1.69e-0877.14%
24 kDa seed maturation protein OS=Elaeis...
HSP 1
Score: 62.3882 bits (150), Expect = 1.68953e-08
Identity = 27/35 (77.14%), Postives = 30/35 (85.71%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLWVLSI+G CC+FL LFYI FV LHT PV+Y
Sbjct: 174 VIAGLWVLSIVGSCCNFLALFYIAFVTLHTVPVLY 208

A2Y6P9_ORYSI2.21e-0871.43%
Putative uncharacterized protein OS=Oryz...
HSP 1
Score: 62.003 bits (149), Expect = 2.20659e-08
Identity = 25/35 (71.43%), Postives = 32/35 (91.43%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
V+AGLWVLS+LG CC+FLTLFYI F++L+T PV+Y
Sbjct: 174 VVAGLWVLSVLGSCCNFLTLFYIVFMVLYTVPVLY 208

Q9AWY7_ORYSJ2.88e-0871.43%
Putative uncharacterized protein OS=Oryz...
HSP 1
Score: 61.6178 bits (148), Expect = 2.8819e-08
Identity = 25/35 (71.43%), Postives = 31/35 (88.57%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLW+LS+LG CC+FLTL YI FV+LHT P++Y
Sbjct: 202 VIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPILY 236

Q0JPF1_ORYSJ2.88e-0871.43%
Os01g0226300 protein (Fragment) OS=Oryza...
HSP 1
Score: 61.6178 bits (148), Expect = 2.8819e-08
Identity = 25/35 (71.43%), Postives = 31/35 (88.57%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLW+LS+LG CC+FLTL YI FV+LHT P++Y
Sbjct: 101 VIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPILY 135

B6TGL5_MAIZE2.88e-0874.29%
Putative uncharacterized protein OS=Zea ...
HSP 1
Score: 61.6178 bits (148), Expect = 2.8819e-08
Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLW+LS+LG CC+FLTLFYI FV L+T PV+Y
Sbjct: 180 VIAGLWLLSVLGSCCNFLTLFYIVFVALYTVPVLY 214

A2WMA1_ORYSI2.88e-0871.43%
Putative uncharacterized protein OS=Oryz...
HSP 1
Score: 61.6178 bits (148), Expect = 2.8819e-08
Identity = 25/35 (71.43%), Postives = 31/35 (88.57%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLW+LS+LG CC+FLTL YI FV+LHT P++Y
Sbjct: 202 VIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPILY 236

B9RCJ7_RICCO3.76e-0880.00%
Putative uncharacterized protein OS=Rici...
HSP 1
Score: 61.2326 bits (147), Expect = 3.76387e-08
Identity = 28/35 (80.00%), Postives = 30/35 (85.71%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLWVLSI+G C+FLTLFYI FVLLHT PV Y
Sbjct: 182 VIAGLWVLSIVGSWCNFLTLFYIAFVLLHTVPVFY 216

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CF810606
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010270080011.09e-1285.71%GSVIVT01027008001 assembled CDS
HSP 1
Score: 67.781 bits (164), Expect = 1.08625e-12
Identity = 30/35 (85.71%), Postives = 32/35 (91.43%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
+IAGLWVLSILG CC+FLTLFYI FVLLHT PVIY
Sbjct: 177 IIAGLWVLSILGSCCNFLTLFYITFVLLHTVPVIY 211

GSVIVT010194400011.33e-1077.14%GSVIVT01019440001 assembled CDS
HSP 1
Score: 60.8474 bits (146), Expect = 1.32786e-10
Identity = 27/35 (77.14%), Postives = 31/35 (88.57%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLWV+SI+G C+FLTLFYI FVLLHT PV+Y
Sbjct: 174 VIAGLWVVSIVGSWCNFLTLFYIVFVLLHTVPVLY 208

GSVIVT010287960012.50e-0971.43%GSVIVT01028796001 assembled CDS
HSP 1
Score: 56.6102 bits (135), Expect = 2.50423e-09
Identity = 25/35 (71.43%), Postives = 29/35 (82.86%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
V AGLWVLS +G C+F+TLFY+ FVLLHT PVIY
Sbjct: 176 VTAGLWVLSAVGRWCNFITLFYLLFVLLHTVPVIY 210

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CF810606
Best 10 Hits Shown

Match Name E value Identity Description
AT4G11220.1 1.78e-0876.47%
VIRB2-interacting protein 2 | chr4:6838...
HSP 1
Score: 54.299 bits (129), Expect = 1.78342e-08
Identity = 26/34 (76.47%), Postives = 27/34 (79.41%), Query Frame = 3
Query:  249 IAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
IAGLWVLSILGGC SFLTL YI VLL T P+ Y
Sbjct: 194 IAGLWVLSILGGCYSFLTLAYIALVLLFTVPLFY 227

AT5G41600.1 2.33e-0871.43%
VIRB2-interacting protein 3 | chr5:1663...
HSP 1
Score: 53.9138 bits (128), Expect = 2.32921e-08
Identity = 25/35 (71.43%), Postives = 28/35 (80.00%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLWVLSI+G C +FLTLFY VLL T PV+Y
Sbjct: 176 VIAGLWVLSIIGSCYNFLTLFYTATVLLFTIPVLY 210

AT4G23630.1 5.19e-0873.53%
VIRB2-interacting protein 1 | chr4:1231...
HSP 1
Score: 52.7582 bits (125), Expect = 5.18895e-08
Identity = 25/34 (73.53%), Postives = 27/34 (79.41%), Query Frame = 3
Query:  249 IAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
IAGLWVLSILGGC +FLTL YI VLL T P+ Y
Sbjct: 198 IAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAY 231

AT1G64090.2 1.97e-0768.57%
Reticulan like protein B3 | chr1:237893...
HSP 1
Score: 50.8322 bits (120), Expect = 1.9718e-07
Identity = 24/35 (68.57%), Postives = 27/35 (77.14%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLWVLS +G C+FLTL YI VLL T PV+Y
Sbjct: 188 VIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLY 222

AT1G64090.1 1.97e-0768.57%
Reticulan like protein B3 | chr1:237893...
HSP 1
Score: 50.8322 bits (120), Expect = 1.9718e-07
Identity = 24/35 (68.57%), Postives = 27/35 (77.14%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
VIAGLWVLS +G C+FLTL YI VLL T PV+Y
Sbjct: 172 VIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLY 206

AT3G10260.3 2.58e-0737.50%
Reticulon family protein | chr3:3171413...
HSP 1
Score: 50.447 bits (119), Expect = 2.57525e-07
Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  195 GFQFGQQSSNGLCFGEQV------------IAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
G G++ + GL F + + + GLWV +++G CC+FLT+ YI FV HT PV+Y
Sbjct: 160 GVAVGKEVNRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVGSCCNFLTVLYIGFVGAHTMPVLY 223

AT3G10260.2 2.58e-0737.50%
Reticulon family protein | chr3:3171413...
HSP 1
Score: 50.447 bits (119), Expect = 2.57525e-07
Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  195 GFQFGQQSSNGLCFGEQV------------IAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
G G++ + GL F + + + GLWV +++G CC+FLT+ YI FV HT PV+Y
Sbjct: 140 GVAVGKEVNRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVGSCCNFLTVLYIGFVGAHTMPVLY 203

AT3G10260.1 2.58e-0737.50%
Reticulon family protein | chr3:3171413...
HSP 1
Score: 50.447 bits (119), Expect = 2.57525e-07
Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  195 GFQFGQQSSNGLCFGEQV------------IAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
G G++ + GL F + + + GLWV +++G CC+FLT+ YI FV HT PV+Y
Sbjct: 140 GVAVGKEVNRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVGSCCNFLTVLYIGFVGAHTMPVLY 203

AT2G46170.1 4.39e-0754.29%
Reticulon family protein | chr2:1896541...
HSP 1
Score: 49.6766 bits (117), Expect = 4.39271e-07
Identity = 19/35 (54.29%), Postives = 28/35 (80.00%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
V+ GLW++S++G +FLTL YI FV+LHT P++Y
Sbjct: 176 VVVGLWIISVVGNWFNFLTLVYICFVILHTVPMLY 210

AT3G61560.1 9.79e-0754.29%
Reticulon family protein | chr3:2277791...
HSP 1
Score: 48.521 bits (114), Expect = 9.78593e-07
Identity = 19/35 (54.29%), Postives = 28/35 (80.00%), Query Frame = 3
Query:  246 VIAGLWVLSILGGCCSFLTLFYIXFVLLHTXPVIY 350
V+ GLW++S++G +FLTL YI FV+LHT P++Y
Sbjct: 176 VVFGLWIISVVGNWFNFLTLVYICFVVLHTVPMLY 210

Related info for CF810606