CF811120

Information for CF811120

NameCF811120
AccessionID2614
Length660 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014530 cDNA cold acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CF811120
Sequence
CGAGTAGGTAACTAACTGATTTGATTTACTCAATTGCTCAAACTCGGCGAGAATTTTGAG
TCAAGTTTGTTTATTAGGACATGATACTCCTAGTACACAAGTTCTTATTCATGCTGCAAC
AAATCACTACAACCAACCTAGAGGGTAACACTTTCTTGGAGACAGTTCGACATTCATGCC
AAATACCTAATTATAGGTAGGTTATTACTTCTCCAACCGGTGAGAAAAATAACAGTCGAA
AAGTTCAAACCTAAGCTCCAGAGCCAGACAATCGCCTCCTGGTGGCATTTGAAATAGATA
CCTGACCAAGTTTATCAGCCTCGACTGTCACCATCCGCTCGGGGAGTGGCATATAGTGCC
TCAACCATACGCCAGTATACACCTGAGCAGGTCTCATTATCTTGGTATCAGGATCATCCA
GGGACTCTCGCCAATGTGATAAGTAGCCAGCCATACGAGGTATTGCAAACAAAACAGTGA
AGAACTCAGCTGGGAAACCCATGGCCCTATAAATTAACCCAGAATAGAAATCAACATTCG
GATATAGCTTCCTCTTGACAAAATATTCATCTGACAGTGCAGCTTTCTCCAAAGCAACAG
CCACCTCAATGAGAGGATCCCGGCCAACAATTGAAAAAACTTCATCTGCCAGTTTCCTAN
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0044262 biological_process cellular carbohydrate metabolic process

KEGG Analysis

Analysis Date: 01-18-2011 (KEGG analysis for Vaccinium corymbosum unigene v1)
K01647 CS, gltA; citrate synthase [EC:2.3.3.1]

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CF811120_5_ORF1 CRC64: 6A592C3A2F627D99 LENGTH: 135 aa
InterPro
IPR002020
Family
Citrate synthase-like
PR00143 [39-55]T 6.1e-12 PR00143 CITRTSNTHASE[59-73]T 6.1e-12 PR00143 CITRTSNTHASE CITRTSNTHASE
PTHR11739 [1-129]T 2e-47 PTHR11739 CITRATE SYNTHASE CITRATE SYNTHASE
PF00285 [2-90]T 2.5e-26 PF00285 Citrate_synt Citrate_synt
InterPro
IPR016141
Domain
Citrate synthase-like, core
SSF48256 [1-108]T 7.2e-37 SSF48256 Citrate synthase Citrate synthase
InterPro
IPR016143
Domain
Citrate synthase-like, small alpha subdomain
G3DSA:1.10.230.10 [1-58]T 1.3e-15 G3DSA:1.10.230.10 no description no description

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CF811120
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0016s090702.38e-6588.06%POPTR_0016s09070.1
HSP 1
Score: 245.358 bits (625), Expect = 2.37567e-65
Identity = 118/134 (88.06%), Postives = 127/134 (94.78%), Query Frame = -3
Query:  257 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEADKLGQVSISNATRRRLSGSG 658
+KLA+EVFSIVGRDPLIEVAVALEKAAL+DEYFVKRKLYPNVDFYSGLIYRAMGFP EFF VLFAIPRMAGYL+HWRESLDDPDTKIMRP QVYTG WLRHYMPL ERM+ +AD+LGQVSISNA+RRRL+GSG
Sbjct: 374 KKLAEEVFSIVGRDPLIEVAVALEKAALADEYFVKRKLYPNVDFYSGLIYRAMGFPTEFFPVLFAIPRMAGYLAHWRESLDDPDTKIMRPQQVYTGEWLRHYMPLKERMIQTDADRLGQVSISNASRRRLAGSG 507

POPTR_0014s138504.64e-6184.21%POPTR_0014s13850.1
HSP 1
Score: 231.106 bits (588), Expect = 4.63641e-61
Identity = 112/133 (84.21%), Postives = 120/133 (90.23%), Query Frame = -3
Query:  260 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEADKLGQVSISNATRRRLSGS 658
+KLA+EVFSIVGRDPLIEVAVALEKAAL DEYFVKRKLYPNVDFYSGLIYRAMGFP EFF VLFAIPRMAGYL+HWRESLDDPDTKIMRP QVYTG WLRHYMPL ER + ADK GQ+S+SNA+ RR +GS
Sbjct: 377 KKLAEEVFSIVGRDPLIEVAVALEKAALDDEYFVKRKLYPNVDFYSGLIYRAMGFPTEFFPVLFAIPRMAGYLAHWRESLDDPDTKIMRPQQVYTGEWLRHYMPLKEREASSNADKPGQISVSNASMRRRAGS 509

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CF811120
Best 10 Hits Shown

Match Name E value Identity Description
ppa004363m 7.05e-6487.31%ppa004363m
HSP 1
Score: 239.965 bits (611), Expect = 7.05291e-64
Identity = 117/134 (87.31%), Postives = 126/134 (94.03%), Query Frame = -3
Query:  257 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEADKLGQVSISNATRRRLSGSG 658
RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFP EFF VLFAIPRMAG+L+HWRESLDDPDTKIMRP QVYTG WLRHY+P ER+VT ++DKL QVS+SNA+RRRL+GSG
Sbjct: 380 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPTEFFPVLFAIPRMAGWLAHWRESLDDPDTKIMRPQQVYTGNWLRHYIPPRERIVTSDSDKLSQVSVSNASRRRLAGSG 513

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CF811120
Best 10 Hits Shown

Match Name E value Identity Description
CYSZ_CUCMA2.24e-6387.31%
Citrate synthase, glyoxysomal OS=Cucurbi...
HSP 1
Score: 241.891 bits (616), Expect = 2.23891e-63
Identity = 117/134 (87.31%), Postives = 127/134 (94.78%), Query Frame = -3
Query:  257 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEADKLGQVSISNATRRRLSGSG 658
RKLA+EVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFP EFFTVLFAIPRMAGYL+HWRESLDDPDTKI+RP QVYTG WLRHY+P ER+V +AD+LGQVS+SNA++RRLSGSG
Sbjct: 382 RKLAEEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPPEFFTVLFAIPRMAGYLAHWRESLDDPDTKIIRPQQVYTGEWLRHYIPPNERLVPAKADRLGQVSVSNASKRRLSGSG 515

CISY3_ARATH2.74e-6185.29%
Citrate synthase 3, peroxisomal OS=Arabi...
HSP 1
Score: 234.958 bits (598), Expect = 2.73689e-61
Identity = 116/136 (85.29%), Postives = 126/136 (92.65%), Query Frame = -3
Query:  260 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVT---VEADKLGQVSISNATRRRLSGS 658
+ LADEVFSIVG+DPLIEVAVALEKAALSD+YFVKRKLYPNVDFYSGLIYRAMGFP EFFTVLFAIPRMAGYLSHW+ESLDDPDTKIMRP QVYTGVWLRHY P+ ER+VT E+DKLGQV+ SNA+RRRL+GS
Sbjct: 372 KNLADEVFSIVGKDPLIEVAVALEKAALSDDYFVKRKLYPNVDFYSGLIYRAMGFPPEFFTVLFAIPRMAGYLSHWKESLDDPDTKIMRPQQVYTGVWLRHYTPVRERIVTDDSKESDKLGQVATSNASRRRLAGS 507

CISY2_ARATH2.74e-6183.94%
Citrate synthase 2, peroxisomal OS=Arabi...
HSP 1
Score: 234.958 bits (598), Expect = 2.73689e-61
Identity = 115/137 (83.94%), Postives = 126/137 (91.97%), Query Frame = -3
Query:  254 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEA--DKLGQVSISNATRRRLSGSGA 658
+KLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFP EFFTVLFA+PRMAGYLSHWRESLDDPDT+IMRP Q YTGVW+RHY P+ ER ++ ++ DK GQVSISNA+RRRL+GS A
Sbjct: 377 KKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPPEFFTVLFAVPRMAGYLSHWRESLDDPDTRIMRPQQAYTGVWMRHYEPVRERTLSSDSDKDKFGQVSISNASRRRLAGSSA 513

CISY1_ARATH9.15e-4176.85%
Citrate synthase 1, peroxisomal OS=Arabi...
HSP 1
Score: 166.777 bits (421), Expect = 9.15334e-41
Identity = 83/108 (76.85%), Postives = 91/108 (84.26%), Query Frame = -3
Query:  335 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPER 658
+KLADEVFSI+GRDPL+EV ALEKAALSDEYFVKRKLYPNVDFYSGLI RAMG P+ F A+ R+AGYLSHWRESLDDPDTKIMRP QVYTG +RHY + ER
Sbjct: 374 KKLADEVFSILGRDPLVEVGDALEKAALSDEYFVKRKLYPNVDFYSGLINRAMGIPSSF----TAVSRIAGYLSHWRESLDDPDTKIMRPQQVYTGAGIRHYETVRER 477

CISYP_DICDI2.49e-3860.31%
Citrate synthase, peroxisomal OS=Dictyos...
HSP 1
Score: 158.688 bits (400), Expect = 2.49269e-38
Identity = 79/131 (60.31%), Postives = 95/131 (72.52%), Query Frame = -3
Query:  266 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEADKLGQVSISNATRRRLS 658
R++A EVF +G++PLIEVA LEK AL DEYFV RKLYPNVDFYSGLIY+AMGFP + F VLF IPR G+L+HW E L+DP+TKI RP QVY G W R+Y+P+ R A Q S S+AT +R S
Sbjct: 360 RRVAYEVFESLGKEPLIEVATELEKQALEDEYFVSRKLYPNVDFYSGLIYKAMGFPTDMFPVLFTIPRAVGWLAHWVEHLEDPETKIYRPRQVYKGEWFRNYVPIDGR---PPAKVRSQDSYSSATTKRYS 487

CISYC_DICDI1.73e-3149.22%
Citrate synthase OS=Dictyostelium discoi...
HSP 1
Score: 135.961 bits (341), Expect = 1.73025e-31
Identity = 63/128 (49.22%), Postives = 91/128 (71.09%), Query Frame = -3
Query:  266 EVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTV--EADKLGQVSISNATRRRLS 643
E+F+++G++PL+++A LE+ ALSD YF++R+LYPNVDFYSG+IY++MGFP + F VLF+IPR AG+L+HW E L DP+ +I RP Q+Y G +Y+P+ R V +KL S RR +S
Sbjct: 346 EIFALLGKNPLMQIATELERLALSDSYFIERQLYPNVDFYSGIIYKSMGFPTDMFPVLFSIPRAAGWLAHWVEELADPELRIFRPRQIYMGRRNMNYVPMDARQVQQHNSGEKLSSFSSGFDRRRDVS 473

CISY_CORGL6.15e-2955.56%
Citrate synthase OS=Corynebacterium glut...
HSP 1
Score: 127.487 bits (319), Expect = 6.15397e-29
Identity = 60/108 (55.56%), Postives = 80/108 (74.07%), Query Frame = -3
Query:  335 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPER 658
++ A E+ +G D L+++A+ LE+ AL+D+YF+ RKLYPNVDFY+GLIYRAMGFP +FFTVLFAI R+ G+++H+RE L KI RP QVYTG R +P ER
Sbjct: 330 KETAHEILEHLGGDDLLDLAIKLEEIALADDYFISRKLYPNVDFYTGLIYRAMGFPTDFFTVLFAIGRLPGWIAHYREQLGAAGNKINRPRQVYTGNESRKLVPREER 437

CISY2_RHITR6.15e-2951.82%
Citrate synthase, plasmid OS=Rhizobium t...
HSP 1
Score: 127.487 bits (319), Expect = 6.15397e-29
Identity = 57/110 (51.82%), Postives = 82/110 (74.55%), Query Frame = -3
Query:  335 RKLADEVFSIVG--RDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPER 658
+K A EV +G DPL+++A+ LE+ AL+D+YF+++KLYPNVDFYSG+ +A+GFP FTVLFA+ R G+++ W E ++DPD +I RP Q+YTG LR Y+PL +R
Sbjct: 320 QKTAHEVLGELGIKDDPLLDIAIELERIALTDDYFIEKKLYPNVDFYSGITLKALGFPTTMFTVLFALARTVGWIAQWNEMIEDPDQRIGRPRQLYTGAPLREYVPLSKR 429

CISY_BRAJA2.34e-2857.73%
Citrate synthase OS=Bradyrhizobium japon...
HSP 1
Score: 125.561 bits (314), Expect = 2.33851e-28
Identity = 56/97 (57.73%), Postives = 73/97 (75.26%), Query Frame = -3
Query:  335 GRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPER 625
G DP+++VA+ LEK ALSD+YF+ RKLYPNVDFYSG+ +AMGFP FTVLFA+ R G++S W E ++DP KI RP Q+YTGV R Y+ + +R
Sbjct: 337 GDDPMLKVAMELEKIALSDQYFIDRKLYPNVDFYSGITLKAMGFPVSMFTVLFAVARTVGWISQWSEMIEDPQQKIGRPRQLYTGVTRRDYVAIKDR 433

CISY_BARHE2.34e-2852.53%
Citrate synthase OS=Bartonella henselae ...
HSP 1
Score: 125.561 bits (314), Expect = 2.33851e-28
Identity = 52/99 (52.53%), Postives = 76/99 (76.77%), Query Frame = -3
Query:  332 VGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERM 628
+ DPL+++A+ LE AL+DEYF+++KLYPNVDFYSG+ +A+GFP E FTVLFA+ R G+++ W+E ++DP KI RP Q+YTG R Y+P+ +R+
Sbjct: 332 IQNDPLLDIAITLENIALNDEYFIEKKLYPNVDFYSGITLKALGFPTEMFTVLFALARSVGWVAQWKEMIEDPAQKISRPRQLYTGYAAREYIPIDKRV 430

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CF811120
Best 10 Hits Shown

Match Name E value Identity Description
D7TMQ2_VITVI1.73e-6388.06%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 246.128 bits (627), Expect = 1.72908e-63
Identity = 118/134 (88.06%), Postives = 128/134 (95.52%), Query Frame = -3
Query:  257 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEADKLGQVSISNATRRRLSGSG 658
+KLA+EVFSIVGRDPLIEVAVALEKAALSDEYF+KRKLYPNVDFYSGLIYRAMGFP EFF VLFAIPRMAGYL+HWRESLDDPDTKIMRP QVYTG WLRH+MP+ ERM++ EAD+LGQVSISNATRRRL+GSG
Sbjct: 378 KKLAEEVFSIVGRDPLIEVAVALEKAALSDEYFIKRKLYPNVDFYSGLIYRAMGFPTEFFPVLFAIPRMAGYLAHWRESLDDPDTKIMRPQQVYTGEWLRHFMPVKERMMSAEADRLGQVSISNATRRRLAGSG 511

B9IFM7_POPTR2.95e-6388.06%
Citrate synthase OS=Populus trichocarpa ...
HSP 1
Score: 245.358 bits (625), Expect = 2.94936e-63
Identity = 118/134 (88.06%), Postives = 127/134 (94.78%), Query Frame = -3
Query:  257 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEADKLGQVSISNATRRRLSGSG 658
+KLA+EVFSIVGRDPLIEVAVALEKAAL+DEYFVKRKLYPNVDFYSGLIYRAMGFP EFF VLFAIPRMAGYL+HWRESLDDPDTKIMRP QVYTG WLRHYMPL ERM+ +AD+LGQVSISNA+RRRL+GSG
Sbjct: 374 KKLAEEVFSIVGRDPLIEVAVALEKAALADEYFVKRKLYPNVDFYSGLIYRAMGFPTEFFPVLFAIPRMAGYLAHWRESLDDPDTKIMRPQQVYTGEWLRHYMPLKERMIQTDADRLGQVSISNASRRRLAGSG 507

D7LJD0_ARALY1.79e-6086.03%
Putative uncharacterized protein OS=Arab...
HSP 1
Score: 236.113 bits (601), Expect = 1.78931e-60
Identity = 117/136 (86.03%), Postives = 126/136 (92.65%), Query Frame = -3
Query:  260 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVT---VEADKLGQVSISNATRRRLSGS 658
+ LADEVFSIVG+DPLIEVAVALEKAALSD+YFVKRKLYPNVDFYSGLIYRAMGFP EFFTVLFAIPRMAGYLSHW+ESLDDPDTKIMRP QVYTGVWLRHY P+ ER+VT E+DKLGQVS SNA+RRRL+GS
Sbjct: 372 KNLADEVFSIVGKDPLIEVAVALEKAALSDDYFVKRKLYPNVDFYSGLIYRAMGFPPEFFTVLFAIPRMAGYLSHWKESLDDPDTKIMRPQQVYTGVWLRHYTPVRERIVTDDSKESDKLGQVSTSNASRRRLAGS 507

Q0WUX6_ARATH3.99e-6085.29%
Citrate synthase OS=Arabidopsis thaliana...
HSP 1
Score: 234.958 bits (598), Expect = 3.98617e-60
Identity = 116/136 (85.29%), Postives = 126/136 (92.65%), Query Frame = -3
Query:  260 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVT---VEADKLGQVSISNATRRRLSGS 658
+ LADEVFSIVG+DPLIEVAVALEKAALSD+YFVKRKLYPNVDFYSGLIYRAMGFP EFFTVLFAIPRMAGYLSHW+ESLDDPDTKIMRP QVYTGVWLRHY P+ ER+VT E+DKLGQV+ SNA+RRRL+GS
Sbjct: 372 KNLADEVFSIVGKDPLIEVAVALEKAALSDDYFVKRKLYPNVDFYSGLIYRAMGFPPEFFTVLFAIPRMAGYLSHWKESLDDPDTKIMRPQQVYTGVWLRHYTPVRERIVTDDSKESDKLGQVATSNASRRRLAGS 507

D7LW72_ARALY3.99e-6083.94%
Putative uncharacterized protein OS=Arab...
HSP 1
Score: 234.958 bits (598), Expect = 3.98617e-60
Identity = 115/137 (83.94%), Postives = 126/137 (91.97%), Query Frame = -3
Query:  254 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEA--DKLGQVSISNATRRRLSGSGA 658
+KLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFP EFFTVLFA+PRMAGYLSHWRESLDDPDT+IMRP Q YTGVW+RHY P+ ER ++ ++ DK GQVSISNA+RRRL+GS A
Sbjct: 377 KKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPPEFFTVLFAVPRMAGYLSHWRESLDDPDTRIMRPQQAYTGVWMRHYEPVRERTLSSDSGTDKFGQVSISNASRRRLAGSSA 513

B9IA46_POPTR5.76e-5984.21%
Citrate synthase OS=Populus trichocarpa ...
HSP 1
Score: 231.106 bits (588), Expect = 5.75602e-59
Identity = 112/133 (84.21%), Postives = 120/133 (90.23%), Query Frame = -3
Query:  260 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEADKLGQVSISNATRRRLSGS 658
+KLA+EVFSIVGRDPLIEVAVALEKAAL DEYFVKRKLYPNVDFYSGLIYRAMGFP EFF VLFAIPRMAGYL+HWRESLDDPDTKIMRP QVYTG WLRHYMPL ER + ADK GQ+S+SNA+ RR +GS
Sbjct: 377 KKLAEEVFSIVGRDPLIEVAVALEKAALDDEYFVKRKLYPNVDFYSGLIYRAMGFPTEFFPVLFAIPRMAGYLAHWRESLDDPDTKIMRPQQVYTGEWLRHYMPLKEREASSNADKPGQISVSNASMRRRAGS 509

D5AAX0_PICSI3.73e-5882.58%
Citrate synthase OS=Picea sitchensis PE=...
HSP 1
Score: 228.409 bits (581), Expect = 3.73094e-58
Identity = 109/132 (82.58%), Postives = 121/132 (91.67%), Query Frame = -3
Query:  263 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEADKLGQVSISNATRRRLSG 658
R LA+EVFSIVGRDPLIEVAVALE+AALSDEYF+KRKLYPNVDFYSGLIYRA+GFP EFF VLFAIPRMAGYL+HW+ESLDDPDTKIMRP Q YTGVWLRHY P+ +R + EADKLGQV++SNATRRR +G
Sbjct: 375 RNLAEEVFSIVGRDPLIEVAVALERAALSDEYFIKRKLYPNVDFYSGLIYRALGFPTEFFPVLFAIPRMAGYLAHWKESLDDPDTKIMRPQQWYTGVWLRHYTPVNKREASEEADKLGQVAVSNATRRRRAG 506

Q6EUF8_ORYSJ4.87e-5881.95%
Citrate synthase OS=Oryza sativa subsp. ...
HSP 1
Score: 228.024 bits (580), Expect = 4.87276e-58
Identity = 109/133 (81.95%), Postives = 122/133 (91.73%), Query Frame = -3
Query:  260 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEADKLGQVSISNATRRRLSGS 658
RKLA+EVFSIVGRDPLIEVAVALEKAALSD+YFVKRKLYPNVDFYSGLIYRAMGFP EFF VLFAIPRMAG+L+HW+ESLDDPDTKIMRP QVYTGVWLRHY P+ ER+ + ++LGQ++ SNATRRR +GS
Sbjct: 366 RKLAEEVFSIVGRDPLIEVAVALEKAALSDDYFVKRKLYPNVDFYSGLIYRAMGFPTEFFPVLFAIPRMAGWLAHWKESLDDPDTKIMRPQQVYTGVWLRHYTPVRERVPASQGEQLGQIATSNATRRRRAGS 498

Q0E2K1_ORYSJ4.87e-5881.95%
Citrate synthase (Fragment) OS=Oryza sat...
HSP 1
Score: 228.024 bits (580), Expect = 4.87276e-58
Identity = 109/133 (81.95%), Postives = 122/133 (91.73%), Query Frame = -3
Query:  260 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEADKLGQVSISNATRRRLSGS 658
RKLA+EVFSIVGRDPLIEVAVALEKAALSD+YFVKRKLYPNVDFYSGLIYRAMGFP EFF VLFAIPRMAG+L+HW+ESLDDPDTKIMRP QVYTGVWLRHY P+ ER+ + ++LGQ++ SNATRRR +GS
Sbjct: 405 RKLAEEVFSIVGRDPLIEVAVALEKAALSDDYFVKRKLYPNVDFYSGLIYRAMGFPTEFFPVLFAIPRMAGWLAHWKESLDDPDTKIMRPQQVYTGVWLRHYTPVRERVPASQGEQLGQIATSNATRRRRAGS 537

B9F4F6_ORYSJ4.87e-5881.95%
Citrate synthase OS=Oryza sativa subsp. ...
HSP 1
Score: 228.024 bits (580), Expect = 4.87276e-58
Identity = 109/133 (81.95%), Postives = 122/133 (91.73%), Query Frame = -3
Query:  260 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEADKLGQVSISNATRRRLSGS 658
RKLA+EVFSIVGRDPLIEVAVALEKAALSD+YFVKRKLYPNVDFYSGLIYRAMGFP EFF VLFAIPRMAG+L+HW+ESLDDPDTKIMRP QVYTGVWLRHY P+ ER+ + ++LGQ++ SNATRRR +GS
Sbjct: 347 RKLAEEVFSIVGRDPLIEVAVALEKAALSDDYFVKRKLYPNVDFYSGLIYRAMGFPTEFFPVLFAIPRMAGWLAHWKESLDDPDTKIMRPQQVYTGVWLRHYTPVRERVPASQGEQLGQIATSNATRRRRAGS 479

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CF811120
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010008170018.41e-6688.06%GSVIVT01000817001 assembled CDS
HSP 1
Score: 246.128 bits (627), Expect = 8.40904e-66
Identity = 118/134 (88.06%), Postives = 128/134 (95.52%), Query Frame = -3
Query:  257 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEADKLGQVSISNATRRRLSGSG 658
+KLA+EVFSIVGRDPLIEVAVALEKAALSDEYF+KRKLYPNVDFYSGLIYRAMGFP EFF VLFAIPRMAGYL+HWRESLDDPDTKIMRP QVYTG WLRH+MP+ ERM++ EAD+LGQVSISNATRRRL+GSG
Sbjct: 378 KKLAEEVFSIVGRDPLIEVAVALEKAALSDEYFIKRKLYPNVDFYSGLIYRAMGFPTEFFPVLFAIPRMAGYLAHWRESLDDPDTKIMRPQQVYTGEWLRHFMPVKERMMSAEADRLGQVSISNATRRRLAGSG 511

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CF811120
Best 10 Hits Shown

Match Name E value Identity Description
AT3G58750.1 2.83e-6283.94%
citrate synthase 2 | chr3:21724564-2172...
HSP 1
Score: 234.958 bits (598), Expect = 2.82586e-62
Identity = 115/137 (83.94%), Postives = 126/137 (91.97%), Query Frame = -3
Query:  254 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVTVEA--DKLGQVSISNATRRRLSGSGA 658
+KLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFP EFFTVLFA+PRMAGYLSHWRESLDDPDT+IMRP Q YTGVW+RHY P+ ER ++ ++ DK GQVSISNA+RRRL+GS A
Sbjct: 377 KKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPPEFFTVLFAVPRMAGYLSHWRESLDDPDTRIMRPQQAYTGVWMRHYEPVRERTLSSDSDKDKFGQVSISNASRRRLAGSSA 513

AT2G42790.1 2.83e-6285.29%
citrate synthase 3 | chr2:17803132-1780...
HSP 1
Score: 234.958 bits (598), Expect = 2.82586e-62
Identity = 116/136 (85.29%), Postives = 126/136 (92.65%), Query Frame = -3
Query:  260 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPERMVT---VEADKLGQVSISNATRRRLSGS 658
+ LADEVFSIVG+DPLIEVAVALEKAALSD+YFVKRKLYPNVDFYSGLIYRAMGFP EFFTVLFAIPRMAGYLSHW+ESLDDPDTKIMRP QVYTGVWLRHY P+ ER+VT E+DKLGQV+ SNA+RRRL+GS
Sbjct: 372 KNLADEVFSIVGKDPLIEVAVALEKAALSDDYFVKRKLYPNVDFYSGLIYRAMGFPPEFFTVLFAIPRMAGYLSHWKESLDDPDTKIMRPQQVYTGVWLRHYTPVRERIVTDDSKESDKLGQVATSNASRRRLAGS 507

AT3G58740.1 9.45e-4276.85%
citrate synthase 1 | chr3:21721066-2172...
HSP 1
Score: 166.777 bits (421), Expect = 9.45091e-42
Identity = 83/108 (76.85%), Postives = 91/108 (84.26%), Query Frame = -3
Query:  335 RKLADEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGFPAEFFTVLFAIPRMAGYLSHWRESLDDPDTKIMRPAQVYTGVWLRHYMPLPER 658
+KLADEVFSI+GRDPL+EV ALEKAALSDEYFVKRKLYPNVDFYSGLI RAMG P+ F A+ R+AGYLSHWRESLDDPDTKIMRP QVYTG +RHY + ER
Sbjct: 374 KKLADEVFSILGRDPLVEVGDALEKAALSDEYFVKRKLYPNVDFYSGLINRAMGIPSSF----TAVSRIAGYLSHWRESLDDPDTKIMRPQQVYTGAGIRHYETVRER 477

Related info for CF811120