CF810502

Information for CF810502

NameCF810502
AccessionID387
Length566 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014530 cDNA cold acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CF810502
Sequence
CGAAAAACTCAACCTCAGCCGTAACGGCTTTACCGGAGAAATCCCAACTTCCTTGCCAAA
CGCCACCTGTAGTCTCAAGTTTCTTGACGTTTCTTCGAATTCGTTTTCTGGACAAATCCC
AGATGGGTTTTTTGAATCCTGTGGTTCCCTCCGTTTTGTTTCATTCGCTGGGAATTCACT
TCAAGGTTCGATTCCCCGTTCGATTACTCTTTCCCCTTCTCTCAGTTACCTAAATTTGTC
GAGCAACAGGTTTTCTGGCGATTTCCCGGATTTCGCGAATGGGTATGTTTCATTGACTAG
GCTAAGGGTATTAGACCTCTCACACAATGCATTATCTGGGTTTATTCCGAAAGGAATCTC
TTTGATACATAATCTAAAGGAGCTCAAATTACAAGGAAATCGTTTCTCTGGAAATCTTCC
AGTCGGTATGGGGCTTTGTCCGCATCTGAGCAAGTTAGATTTGAGTGATAATCTCTTCAC
CGGGTCAATTCCTGATTCGCTTCATTTGTTAAATTCACTAACTTTTTTGAGTTTATCAAA
CAATATGTTCACTGGGGATTTGCCCA
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0005515 molecular_function protein binding

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CF810502_1_ORF2 CRC64: E8188CAA5BADCED6 LENGTH: 54 aa
noIPR
unintegrated
unintegrated
seg [16-29]? NA seg seg seg
SEQUENCE: CF810502_2_ORF1 CRC64: 28D00D5256D8110B LENGTH: 188 aa
InterPro
IPR001611
Repeat
Leucine-rich repeat
PF00560 [1-20]T 0.28 PF00560 LRR_1[24-47]T 0.014 PF00560 LRR_1[73-93]T 0.029 PF00560 LRR_1[100-118]T 0.053 PF00560 LRR_1[124-141]T 0.3 PF00560 LRR_1[148-167]T 0.083 PF00560 LRR_1[172-188]T 0.89 PF00560 LRR_1 LRR_1
noIPR
unintegrated
unintegrated
PR00019 [25-38]T 1.4e-05 PR00019 LEURICHRPT[98-111]T 1.4e-05 PR00019 LEURICHRPT LEURICHRPT
G3DSA:3.80.10.10 [2-188]T 8.9e-46 G3DSA:3.80.10.10 no description no description
PTHR23258 [3-188]T 6e-50 PTHR23258 SERINE-THREONINE PROTEIN KINASE, PLANT-TYPE SERINE-THREONINE PROTEIN KINASE, PLANT-TYPE
PS51450 [24-46]T 5.255 PS51450 LRR[49-71]T 4.570 PS51450 LRR[73-95]T 6.010 PS51450 LRR[100-122]T 6.618 PS51450 LRR[124-146]T 5.656 PS51450 LRR[148-170]T 7.204 PS51450 LRR[172-188]T 5.525 PS51450 LRR LRR
seg [70-82]? NA seg seg[166-181]? NA seg seg seg
SSF52058 [1-186]T 8.6e-44 SSF52058 L domain-like L domain-like

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CF810502
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0014s144403.23e-4652.13%POPTR_0014s14440.1
HSP 1
Score: 181.415 bits (459), Expect = 3.23466e-46
Identity = 98/188 (52.13%), Postives = 120/188 (63.83%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E LNLS N +G IP+ L N + SLKFLD+S NSF+G +PD F + SLR++S AGN LQG IP S+ +FSGD PDF G SL RLR LDLSHN SG +P+G+S IHNLKEL LQGNRFSG LPV +GLC HL++LDLS NLF+G++P+ M TG+ P
Sbjct: 126 ESLNLSHNSLSGLIPSFLDNMS-SLKFLDLSENSFTGPLPDDLFRNSFSLRYLSLAGNLLQGPIPSSLFSCSSLNTINLSNNQFSGD-PDFVTGTWSLERLRKLDLSHNEFSGSVPQGVSAIHNLKELHLQGNRFSGPLPVDIGLCRHLNRLDLSSNLFSGALPESLQGLSSINYFSLSKNMLTGEFP 311

HSP 2
Score: 87.8113 bits (216), Expect = 4.86732e-18
Identity = 56/164 (34.15%), Postives = 82/164 (50.00%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
KL+LS N F+G +P + +A +LK L + N FSG +P C L + + N G++P S+ +G+FP + SL+ L LDLS NAL+G I I + +L+ L L N+ GN+P + C LS + L N F GSIP+
Sbjct: 226 KLDLSHNEFSGSVPQGV-SAIHNLKELHLQGNRFSGPLPVDI-GLCRHLNRLDLSSNLFSGALPESLQGLSSINYFSLSKNMLTGEFPRWIG---SLSNLEYLDLSSNALTGSISSSIGDLKSLRYLSLSNNKLLGNIPASIVSCTMLSAIRLRGNSFNGSIPE 384

HSP 3
Score: 78.5666 bits (192), Expect = 2.9529e-15
Identity = 57/162 (35.19%), Postives = 82/162 (50.62%), Query Frame = 2
Query:   11 NLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGIS-LIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+LS+N TGE P + + + +L++LD+SSN+ +G I + SLR++S + N L G+IP SI F+G P+ G L L +D SHN L G IP G S +L L L N +G++P MGL L L+LS N +P
Sbjct: 300 SLSKNMLTGEFPRWIGSLS-NLEYLDLSSNALTGSISSSIGD-LKSLRYLSLSNNKLLGNIPASIVSCTMLSAIRLRGNSFNGSIPE---GLFDLG-LEEVDFSHNGLIGSIPSGSSTFFTSLHTLDLSRNNLTGHIPAEMGLSSDLRYLNLSWNNLESRMP 455

HSP 4
Score: 77.411 bits (189), Expect = 6.57837e-15
Identity = 54/164 (32.93%), Postives = 81/164 (49.39%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPD--GFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LSRN TG IP + + L++L++S N+ ++P G+F++ L + N+L GSIP I G P+ SL +L LS N LSG IPK IS + LK LKL+ N +G +P +G +L +++S N G +P
Sbjct: 419 LDLSRNNLTGHIPAEM-GLSSDLRYLNLSWNNLESRMPPELGYFQN---LTVLDLRSNALAGSIPADICESGSLNILQLDGNSLVGQVPEEIGNCSSLY---LLSLSQNNLSGSIPKSISRLDKLKILKLEFNELTGEVPQELGKLENLLAVNISYNKLIGRLP 575

HSP 5
Score: 75.8702 bits (185), Expect = 1.91401e-14
Identity = 66/208 (31.73%), Postives = 87/208 (41.83%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPR-SITXXXXXXXXXXXXXRFSGDFPDFAN-----GYVSLT----------------RLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+LS N G IP S+ + T L + + NSF+G IP+G F+ L V F+ N L GSIP S T +G P Y++L+ L VLDL NAL+G IP I +L L+L GN G +P +G C L L LS N +GSIP TG++P
Sbjct: 347 LSLSNNKLLGNIPASIVSCTM-LSAIRLRGNSFNGSIPEGLFDL--GLEEVDFSHNGLIGSIPSGSSTFFTSLHTLDLSRNNLTGHIPAEMGLSSDLRYLNLSWNNLESRMPPELGYFQNLTVLDLRSNALAGSIPADICESGSLNILQLDGNSLVGQVPEEIGNCSSLYLLSLSQNNLSGSIPKSISRLDKLKILKLEFNELTGEVP 551

HSP 6
Score: 72.7886 bits (177), Expect = 1.62031e-13
Identity = 54/165 (32.73%), Postives = 80/165 (48.48%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCS-LKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++L+L N F+G +P + C L LD+SSN FSG +P+ + S+ + S + N L G PR I +G ++ L LR L LS+N L G IP I L ++L+GN F+G++P G+ L ++D S N GSIP
Sbjct: 249 KELHLQGNRFSGPLPVDI--GLCRHLNRLDLSSNLFSGALPESL-QGLSSINYFSLSKNMLTGEFPRWIGSLSNLEYLDLSSNALTGSI---SSSIGDLKSLRYLSLSNNKLLGNIPASIVSCTMLSAIRLRGNSFNGSIPEGL-FDLGLEEVDFSHNGLIGSIP 406

HSP 7
Score: 54.299 bits (129), Expect = 5.9637e-08
Identity = 48/168 (28.57%), Postives = 70/168 (41.67%), Query Frame = 2
Query:   59 NATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCP-HLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGD 559
++ CS KF++ N SG++ VS G L G + + + FSGDF + + ++ L L+LSHN+LSG IP + + +LK L L N F+G LP + L L L+ NL G IP F+GD
Sbjct: 60 DSPCSWKFIEC--NPVSGRVSQ-----------VSLDGLGLSGRLGKGLQKLQHVKTLSLSHNNFSGDF---SLEFGLISSLESLNLSHNSLSGLIPSFLDNMSSLKFLDLSENSFTGPLPDDLFRNSFSLRYLSLAGNLLQGPIPSSLFSCSSLNTINLSNNQFSGD 211

POPTR_0002s234709.41e-4651.06%POPTR_0002s23470.1
HSP 1
Score: 179.874 bits (455), Expect = 9.41143e-46
Identity = 96/188 (51.06%), Postives = 121/188 (64.36%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E+LNLS N +G IP+ L N + S+KFLD+S NSFSG +PD F + SLR++S AGN LQG IP S+ FSGD PDF++G SL RLR LDLSHN SG +P+G+S IH LKEL+LQGNRFSG LP +GLCPHL++LDLS NLF+G++P+ M G+ P
Sbjct: 132 ERLNLSHNSLSGLIPSFLDNMS-SIKFLDLSENSFSGPLPDNLFRNSHSLRYLSLAGNLLQGPIPSSLLSCSSLNTINLSNNHFSGD-PDFSSGIWSLKRLRKLDLSHNEFSGSVPQGVSAIHFLKELQLQGNRFSGPLPGDIGLCPHLNRLDLSRNLFSGALPESLQRLSSMSLFSLSKNMLAGEFP 317

HSP 2
Score: 91.2781 bits (225), Expect = 4.4023e-19
Identity = 59/164 (35.98%), Postives = 82/164 (50.00%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
KL+LS N F+G +P + +A LK L + N FSG +P G C L + + N G++P S+ +G+FP + SLT L LDLS NAL+G IP I + +L+ L L N+ G +P M C LS + L N F GSIP+
Sbjct: 232 KLDLSHNEFSGSVPQGV-SAIHFLKELQLQGNRFSGPLP-GDIGLCPHLNRLDLSRNLFSGALPESLQRLSSMSLFSLSKNMLAGEFPRWIG---SLTNLEYLDLSSNALTGSIPSSIGDLKSLRYLSLSNNKLFGIIPTSMVSCTMLSVIRLRGNSFNGSIPE 390

HSP 3
Score: 79.7221 bits (195), Expect = 1.3255e-15
Identity = 67/208 (32.21%), Postives = 90/208 (43.27%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPR-SITXXXXXXXXXXXXXRFSGDFPDFAN-----GYVSLT----------------RLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+LS N G IPTS+ + T L + + NSF+G IP+G F+ L V F+ N L GSIP SIT +G P Y++L+ L VLDL ++AL G IP I +L L+L GN G +P +G C L L LS N +GSIP+ TG++P
Sbjct: 353 LSLSNNKLFGIIPTSMVSCTM-LSVIRLRGNSFNGSIPEGLFDL--RLEEVDFSDNGLVGSIPSGSITFFSSLHTLDLSKNNLTGHIPAERGLSSNLRYLNLSWNNLESRMPLELGYFQNLTVLDLRNSALVGLIPADICESGSLNILQLDGNSLVGQIPEEIGNCSSLYLLSLSQNNLSGSIPESISRLNKLKILKLEFNELTGEIP 557

HSP 4
Score: 70.8626 bits (172), Expect = 6.15717e-13
Identity = 52/156 (33.33%), Postives = 73/156 (46.79%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNL 475
LNLS N +P L +L LD+ +++ G IP ES GSL + GNSL G IP I SG P+ + L +L++L L N L+G IP+ + + NL + + N+ G LPVG G+ P L + L NL
Sbjct: 449 LNLSWNNLESRMPLELGYFQ-NLTVLDLRNSALVGLIPADICES-GSLNILQLDGNSLVGQIPEEIGNCSSLYLLSLSQNNLSGSIPESIS---RLNKLKILKLEFNELTGEIPQELGKLENLLAVNVSYNKLVGRLPVG-GIFPSLDRSALQGNL 598

HSP 5
Score: 69.3218 bits (168), Expect = 1.79146e-12
Identity = 50/164 (30.49%), Postives = 81/164 (49.39%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPD--GFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS+N TG IP + +L++L++S N+ ++P G+F++ L + ++L G IP I G P+ SL +L LS N LSG IP+ IS ++ LK LKL+ N +G +P +G +L +++S N G +P
Sbjct: 425 LDLSKNNLTGHIPAER-GLSSNLRYLNLSWNNLESRMPLELGYFQN---LTVLDLRNSALVGLIPADICESGSLNILQLDGNSLVGQIPEEIGNCSSLY---LLSLSQNNLSGSIPESISRLNKLKILKLEFNELTGEIPQELGKLENLLAVNVSYNKLVGRLP 581

POPTR_0019s086701.91e-3039.04%POPTR_0019s08670.1
HSP 1
Score: 129.028 bits (323), Expect = 1.90516e-30
Identity = 73/187 (39.04%), Postives = 101/187 (54.01%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
KL+LSRN TG I +L +L+ +D+S NS SG I + FF+ C +LR +S A N G IP S++ +F+G P G L LR LDLS N L G IPKGI +++NL+ + L NRF+G +P G+G C L +D S+N+ +G IPD MFTG++P
Sbjct: 100 KLSLSRNNLTGSINPNLTRLE-NLRIIDLSENSLSGTISEDFFKECAALRDLSLANNKFSGKIPGSLSSCASLASINLSSNQFTGSLPA---GIWGLNGLRSLDLSGNLLDGEIPKGIEVLNNLRRINLSKNRFNGEVPDGIGSCLLLRSVDFSENMLSGHIPDTMQKLGLCDYLSLSSNMFTGEVP 282

HSP 2
Score: 98.5969 bits (244), Expect = 2.75743e-21
Identity = 62/162 (38.27%), Postives = 84/162 (51.85%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N GEIP + +L+ +++S N F+G++PDG SC LR V F+ N L G IP ++ F+G+ P++ L RL LDLS N SG +P I + LK L L N SGNLP M C +L LD S NL +G +P
Sbjct: 198 LDLSGNLLDGEIPKGI-EVLNNLRRINLSKNRFNGEVPDGI-GSCLLLRSVDFSENMLSGHIPDTMQKLGLCDYLSLSSNMFTGEVPNWIG---ELNRLETLDLSGNRFSGQVPISIGKLQLLKVLNLSANGLSGNLPESMANCGNLLALDFSQNLLSGDLP 354

HSP 3
Score: 95.5153 bits (236), Expect = 2.3343e-20
Identity = 68/210 (32.38%), Postives = 99/210 (47.14%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIP------------------------KGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+L+ N F+G+IP SL ++ SL +++SSN F+G +P G + G LR + +GN L G IP+ I RF+G+ PD G S LR +D S N LSG IP I ++ L+ L L GNRFSG +P+ +G L L+LS N +G++P+ + +GDLP
Sbjct: 150 LSLANNKFSGKIPGSL-SSCASLASINLSSNQFTGSLPAGIWGLNG-LRSLDLSGNLLDGEIPKGIEVLNNLRRINLSKNRFNGEVPD---GIGSCLLLRSVDFSENMLSGHIPDTMQKLGLCDYLSLSSNMFTGEVPNWIGELNRLETLDLSGNRFSGQVPISIGKLQLLKVLNLSANGLSGNLPESMANCGNLLALDFSQNLLSGDLP 354

HSP 4
Score: 85.5001 bits (210), Expect = 2.41562e-17
Identity = 60/164 (36.59%), Postives = 82/164 (50.00%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E L+LS N F+G++P S+ LK L++S+N SG +P+ +CG+L + F+ N L G +P I + SG F S RL+ LDLSHN SG I I ++ +L+ L L N G +P G L LDLSDN GSIP
Sbjct: 292 ETLDLSGNRFSGQVPISIGKLQL-LKVLNLSANGLSGNLPES-MANCGNLLALDFSQNLLSGDLPTWI-FGSRSEKVLHLENKLSGKFS-------SAPRLQFLDLSHNDFSGKIASSIGVLSSLQFLNLSKNSLFGPVPGTFGDLKELDILDLSDNKLNGSIP 445

HSP 5
Score: 82.8037 bits (203), Expect = 1.56576e-16
Identity = 65/204 (31.86%), Postives = 81/204 (39.71%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIP------------------DGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
LNLS NG +G +P S+ N +L LD S N SG +P G F S L+F+ + N G I SI G P + L L +LDLS N L+G IP I LKEL+L+ N SG +P +G C L L LS N G+IP TG LP
Sbjct: 318 LNLSANGLSGNLPESMANCG-NLLALDFSQNLLSGDLPTWIFGSRSEKVLHLENKLSGKFSSAPRLQFLDLSHNDFSGKIASSIGVLSSLQFLNLSKNSLFGPVP---GTFGDLKELDILDLSDNKLNGSIPTEIGGAFALKELRLERNSLSGQIPDSIGNCSSLMTLILSQNNLAGTIPAAIAKLGNLKDVDLSLNSLTGSLP 517

HSP 6
Score: 82.4185 bits (202), Expect = 2.04495e-16
Identity = 56/162 (34.57%), Postives = 79/162 (48.77%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N F+G+I +S+ SL+FL++S NS G +P G F L + + N L GSIP I SG PD SL L LS N L+G IP I+ + NLK++ L N +G+LP + P+L ++S N G +P
Sbjct: 385 LDLSHNDFSGKIASSI-GVLSSLQFLNLSKNSLFGPVP-GTFGDLKELDILDLSDNKLNGSIPTEIGGAFALKELRLERNSLSGQIPDSIGNCSSLM---TLILSQNNLAGTIPAAIAKLGNLKDVDLSLNSLTGSLPKQLANLPNLISFNISHNNLQGELP 541

HSP 7
Score: 58.151 bits (139), Expect = 4.13e-09
Identity = 42/131 (32.06%), Postives = 61/131 (46.56%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGN 400
L+LS N G IPT + A +LK L + NS SGQIPD +C SL + + N+L G+IP +I +G P +L L ++SHN L G +P G+ + + + GN
Sbjct: 433 LDLSDNKLNGSIPTEIGGAF-ALKELRLERNSLSGQIPDSI-GNCSSLMTLILSQNNLAGTIPAAIAKLGNLKDVDLSLNSLTGSLP---KQLANLPNLISFNISHNNLQGELPAGV-FFNTISPSSVSGN 557

POPTR_0013s094003.25e-3037.97%POPTR_0013s09400.1
HSP 1
Score: 128.257 bits (321), Expect = 3.2497e-30
Identity = 71/187 (37.97%), Postives = 102/187 (54.55%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
KL+LSRN TG I +L +L+ +D+S NS SG IP+ FF+ CG+LR +S A N G IP +++ +FSG P G L L LDLS N L IP+GI +++NL+ + L NRF+G +P G+G C L +D S+N+ +G++PD MFTG++P
Sbjct: 102 KLSLSRNCLTGSINPNLTRLE-NLRIIDLSENSLSGTIPEDFFKDCGALRDISLAKNKFSGKIPSTLSSCASLASINLSSNQFSGSLPA---GIWGLNGLSSLDLSGNLLDSEIPRGIEVLNNLRNINLSKNRFNGGVPNGIGSCLLLRSVDFSENMLSGTVPDTMQNLGLCNYLSLSNNMFTGEVP 284

HSP 2
Score: 92.4337 bits (228), Expect = 1.9761e-19
Identity = 58/162 (35.80%), Postives = 83/162 (51.23%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N EIP + +L+ +++S N F+G +P+G SC LR V F+ N L G++P ++ F+G+ P++ L RL LDLS N SG +P I + +LK L N SGNLP M C +L LD S NL +G +P
Sbjct: 200 LDLSGNLLDSEIPRGI-EVLNNLRNINLSKNRFNGGVPNGI-GSCLLLRSVDFSENMLSGTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIG---ELNRLETLDLSGNRFSGQVPTSIGNLQSLKVFNLSANSLSGNLPESMTNCGNLLVLDCSQNLLSGDLP 356

HSP 3
Score: 89.7373 bits (221), Expect = 1.28087e-18
Identity = 64/210 (30.48%), Postives = 96/210 (45.71%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIP------------------------KGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
++L++N F+G+IP++L ++ SL +++SSN FSG +P G + G L + +GN L IPR I RF+G P NG S LR +D S N LSG +P I ++ L+ L L GNRFSG +P +G L +LS N +G++P+ + +GDLP
Sbjct: 152 ISLAKNKFSGKIPSTL-SSCASLASINLSSNQFSGSLPAGIWGLNG-LSSLDLSGNLLDSEIPRGIEVLNNLRNINLSKNRFNGGVP---NGIGSCLLLRSVDFSENMLSGTVPDTMQNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFSGQVPTSIGNLQSLKVFNLSANSLSGNLPESMTNCGNLLVLDCSQNLLSGDLP 356

HSP 4
Score: 88.9669 bits (219), Expect = 2.18484e-18
Identity = 62/164 (37.80%), Postives = 84/164 (51.22%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E L+LS N F+G++PTS+ N SLK ++S+NS SG +P+ +CG+L + + N L G +P I + SG F S +L+VLDLSHN SG I I + +L+ L L N G +P G L LDLSDN GSIP
Sbjct: 294 ETLDLSGNRFSGQVPTSIGNLQ-SLKVFNLSANSLSGNLPES-MTNCGNLLVLDCSQNLLSGDLPVWI-FGSGLEKVLQLENKLSGKFS-------SAQKLQVLDLSHNDFSGKIASSIGVSSSLQFLNLSRNSLMGPIPGTFGDLKELDVLDLSDNKLNGSIP 447

HSP 5
Score: 83.9593 bits (206), Expect = 7.02839e-17
Identity = 58/162 (35.80%), Postives = 80/162 (49.38%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N F+G+I +S+ + SL+FL++S NS G IP G F L + + N L GSIP I SG P SLT L LS N LSG IP I+ + NL+++ + N SG LP + P+LS ++S N G +P
Sbjct: 387 LDLSHNDFSGKIASSI-GVSSSLQFLNLSRNSLMGPIP-GTFGDLKELDVLDLSDNKLNGSIPMEIGGAFALKELRLERNSLSGQIPSSIGTCSSLT---TLILSQNNLSGTIPVAIAKLGNLQDVDVSFNSLSGTLPKQLANLPNLSSFNISHNNLQGELP 543

HSP 6
Score: 73.1738 bits (178), Expect = 1.24063e-13
Identity = 57/180 (31.67%), Postives = 81/180 (45.00%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPV---GMGL----------------CPHLSKLDLSDNLFTGSI 490
+NLS+N F G +P + + L+ +D S N SG +PD ++ G ++S + N G +P I RFSG P +L L+V +LS N+LSG +P+ ++ NL L N SG+LPV G GL L LDLS N F+G I
Sbjct: 224 INLSKNRFNGGVPNGIGSCLL-LRSVDFSENMLSGTVPDTM-QNLGLCNYLSLSNNMFTGEVPNWIGELNRLETLDLSGNRFSGQVPTSIG---NLQSLKVFNLSANSLSGNLPESMTNCGNLLVLDCSQNLLSGDLPVWIFGSGLEKVLQLENKLSGKFSSAQKLQVLDLSHNDFSGKI 398

POPTR_0016s144105.54e-3039.78%POPTR_0016s14410.1
HSP 1
Score: 127.487 bits (319), Expect = 5.54315e-30
Identity = 74/186 (39.78%), Postives = 100/186 (53.76%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+L+ N F G I LP L+ +D+S N SG IPDGFF+ CGSLR VSFA N L G IP S++ SG+ P +G L L+ LDLS N L G IP+GI+ ++ L+ + L+ NRF+G LPV +G C L LD S+N +G +P+ FTG++P
Sbjct: 96 LSLANNNFNGTINPDLPRLG-GLQVIDLSENGLSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSFCMSLSVVNFSSNGLSGELP---SGLWYLRGLQSLDLSDNLLEGEIPEGIANLYALRAINLRRNRFTGQLPVDIGGCQVLKLLDFSENALSGGLPESLQRLSSCATVRLGGNSFTGEVP 277

HSP 2
Score: 92.8189 bits (229), Expect = 1.51305e-19
Identity = 58/164 (35.37%), Postives = 86/164 (52.44%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+ L+LS N GEIP + N +L+ +++ N F+GQ+P C L+ + F+ N+L G +P S+ F+G+ P + LT L LDLS N LSG IP I ++ LKEL L N+ +G LP M C +L +D+S N TG++P
Sbjct: 191 QSLDLSDNLLEGEIPEGIANLY-ALRAINLRRNRFTGQLPVDI-GGCQVLKLLDFSENALSGGLPESLQRLSSCATVRLGGNSFTGEVPGWIG---ELTSLESLDLSVNRLSGRIPVSIGNLNVLKELNLSMNQLTGGLPESMANCVNLLAIDVSHNRLTGNLP 349

HSP 3
Score: 85.8853 bits (211), Expect = 1.84958e-17
Identity = 60/188 (31.91%), Postives = 86/188 (45.74%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
++LNLS N TG +P S+ N +L +DVS N +G +P F++ L+ VS +GN L SI + P + SL L+VLDLS N SG IP I ++ +L+ + N+ G++P +G + LDLSDN TGSIP TG +P
Sbjct: 311 KELNLSMNQLTGGLPESMANCV-NLLAIDVSHNRLTGNLPSWIFKT--GLKSVSLSGNKLDESI----------------------EHPSGVSLAASLESLQVLDLSSNVFSGEIPSDIGVLSSLQLFNVSRNQLFGSIPPSVGELTMIQALDLSDNRLTGSIPSEIGGAVSLKELRLEMNFLTGKIP 473

HSP 4
Score: 81.2629 bits (199), Expect = 4.55567e-16
Identity = 60/172 (34.88%), Postives = 78/172 (45.35%), Query Frame = 2
Query:   50 SLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
SL + SL+ LD+SSN FSG+IP SL+ + + N L GSIP S+ R +G P G VSL LR L N L+G IP I +L L + GN SG +PV + +L +DLS N F+GS+P GDLP
Sbjct: 378 SLAASLESLQVLDLSSNVFSGEIPSDI-GVLSSLQLFNVSRNQLFGSIPPSVGELTMIQALDLSDNRLTGSIPSEIGGAVSLKELR---LEMNFLTGKIPTQIKKCSSLTSLIISGNNLSGPIPVAIANLTNLQYVDLSFNRFSGSLPKELANLSHLLSFNISHNNLKGDLP 545

HSP 5
Score: 62.7734 bits (151), Expect = 1.67676e-10
Identity = 44/142 (30.99%), Postives = 67/142 (47.18%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVG 427
+ L+LS N TG IP+ + A SLK L + N +G+IP + C SL + +GN+L G IP +I +LT L+ +DLS N SG +PK ++ + +L + N G+LP+G
Sbjct: 435 QALDLSDNRLTGSIPSEIGGAV-SLKELRLEMNFLTGKIPTQI-KKCSSLTSLIISGNNLSGPIPVAIA---------------------------NLTNLQYVDLSFNRFSGSLPKELANLSHLLSFNISHNNLKGDLPLG 547

POPTR_0006s109102.75e-2939.78%POPTR_0006s10910.1
HSP 1
Score: 125.176 bits (313), Expect = 2.75104e-29
Identity = 74/186 (39.78%), Postives = 101/186 (54.30%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+L+ N F G I LP L+ +D+S NS SG IPDGFF+ CGSLR VSFA N L G IP S++ G+ P +G L L+ LDLS N L G IP+GI+ +++L+ + L+ NRF+G LPV +G L LD S+N +GS+P+ FTG++P
Sbjct: 97 LSLANNKFNGTINPDLPRLG-GLQVIDLSDNSLSGSIPDGFFQQCGSLRSVSFARNDLTGMIPGSLSSCMTLSLVNFSSNGLCGELP---SGLWYLRGLQSLDLSDNLLEGEIPEGIANLYDLRVINLKNNRFTGQLPVDIGGSQVLKLLDFSENSLSGSLPESLRRLSSCATVRLGGNSFTGEVP 278

HSP 2
Score: 90.5077 bits (223), Expect = 7.50919e-19
Identity = 59/164 (35.98%), Postives = 86/164 (52.44%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+ L+LS N GEIP + N L+ +++ +N F+GQ+P S L+ + F+ NSL GS+P S+ F+G+ P + LT L LDLS N SG IP I ++ LKEL L N+ +G LP M C +L +D+S N TG++P
Sbjct: 192 QSLDLSDNLLEGEIPEGIANLY-DLRVINLKNNRFTGQLPVDIGGS-QVLKLLDFSENSLSGSLPESLRRLSSCATVRLGGNSFTGEVPGWIG---ELTDLESLDLSANRFSGRIPVSIGNLNVLKELNLSMNQLTGGLPESMMNCLNLLAIDVSHNRLTGNLP 350

HSP 3
Score: 84.7297 bits (208), Expect = 4.12043e-17
Identity = 62/190 (32.63%), Postives = 90/190 (47.37%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRF--SGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E L+LS N F+G IP S+ N LK L++S N +G +P+ +C +L + + N L G++P I RF S P + VS+ L+VLDLS N SG IP I ++ +L L + N+ G++P +G + LDLSDN GSIP + TG +P
Sbjct: 288 ESLDLSANRFSGRIPVSIGNLNV-LKELNLSMNQLTGGLPESMM-NCLNLLAIDVSHNRLTGNLPSWI-FKSGLNRVSPSGNRFDESKQHPSGVSLAVSIQGLQVLDLSSNVFSGEIPSDIGVLSSLLLLNVSRNQLFGSIPSSIGDLTMIRALDLSDNRLNGSIPSEIGGAISLTELRLEKNLLTGKIP 474

HSP 4
Score: 76.2554 bits (186), Expect = 1.46551e-14
Identity = 58/172 (33.72%), Postives = 76/172 (44.19%), Query Frame = 2
Query:   50 SLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
SL + L+ LD+SSN FSG+IP SL ++ + N L GSIP SI R +G P G +SLT LR L N L+G IP I +L L L N +G +PV + +L +DLS N +GS+P GDLP
Sbjct: 379 SLAVSIQGLQVLDLSSNVFSGEIPSDI-GVLSSLLLLNVSRNQLFGSIPSSIGDLTMIRALDLSDNRLNGSIPSEIGGAISLTELR---LEKNLLTGKIPTQIKKCSSLASLILSWNNLTGPIPVAVANLINLQYVDLSFNRLSGSLPKELTNLSHLLSFNISHNNLQGDLP 546

HSP 5
Score: 63.1586 bits (152), Expect = 1.28385e-10
Identity = 44/140 (31.43%), Postives = 66/140 (47.14%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVG 427
LN+SRN G IP+S+ + T ++ LD+S N +G IP + SL + N L G IP I +G P +L L+ +DLS N LSG +PK ++ + +L + N G+LP+G
Sbjct: 414 LNVSRNQLFGSIPSSIGDLTM-IRALDLSDNRLNGSIPSEIGGAI-SLTELRLEKNLLTGKIPTQIKKCSSLASLILSWNNLTGPIPV---AVANLINLQYVDLSFNRLSGSLPKELTNLSHLLSFNISHNNLQGDLPLG 548

POPTR_0039s003802.49e-2235.48%POPTR_0039s00380.1
HSP 1
Score: 102.064 bits (253), Expect = 2.49399e-22
Identity = 66/186 (35.48%), Postives = 89/186 (47.85%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+LS N F+G+IP SL N T L FLD+SSN+FSGQIP + L F+ + N+ G IP+S+ FSG P SL+ L LDLS N SG IP + + L+ L L N+F G +P +G ++ LDLS+N G I +F G +P
Sbjct: 230 LDLSSNNFSGQIPPSLSNLT-QLTFLDLSSNNFSGQIPQSL-RNLTQLTFLDLSSNNFSGQIPQSLRNLTQLTFLDLSSNNFSGHIPP------SLSNLTFLDLSSNNFSGHIPSSLGNLVQLRSLDLGSNKFMGQVPDFLGSLVNILYLDLSNNQLVGPIHSQLNTLSNLQYLYLSNNLFNGTIP 407

HSP 2
Score: 100.138 bits (248), Expect = 9.47714e-22
Identity = 64/163 (39.26%), Postives = 87/163 (53.37%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L+LS N F+G+IP SL N T L FLD+SSN+FSG IP S +L F+ + N+ G IP S+ +F G PDF SL + LDLS+N L G I ++ + NL+ L L N F+G +P + P L LDL +N F G+I +
Sbjct: 278 LDLSSNNFSGQIPQSLRNLT-QLTFLDLSSNNFSGHIPP----SLSNLTFLDLSSNNFSGHIPSSLGNLVQLRSLDLGSNKFMGQVPDFLG---SLVNILYLDLSNNQLVGPIHSQLNTLSNLQYLYLSNNLFNGTIPSFLFALPSLYYLDLHNNNFIGNISE 432

HSP 3
Score: 72.4034 bits (176), Expect = 2.11619e-13
Identity = 65/208 (31.25%), Postives = 82/208 (39.42%), Query Frame = 2
Query:    2 EKLNLSRN-GFTGEIPTS-------------------LPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E L LS N G TG P+S L N T L LD+SSN+FSGQIP S +L + + N+ G IP S L+ L +LDLS N SG IP +S + L L L N FSG +P + L+ LDLS N F+G IP F+G +P
Sbjct: 142 ESLYLSYNEGLTGSFPSSNLKYMSLRNCNIIRSDLALLGNLT-QLILLDLSSNNFSGQIPP----SLSNLTILDLSSNNFSGQIPPS------------------------------LSNLTILDLSSNNFSGQIPPSLSNLTQLTFLDLSSNNFSGQIPQSLRNLTQLTFLDLSSNNFSGQIPQSLRNLTQLTFLDLSSNNFSGHIP 314

HSP 4
Score: 67.0106 bits (162), Expect = 8.89093e-12
Identity = 44/142 (30.99%), Postives = 65/142 (45.77%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFI--PKGISLIHNLKELKLQGNRFSGNLPVG 427
L+LS N +G +P L N + L L + N+ G IP F + SL +++ GN ++G I SI + FP F +L +L++L L N L GF+ P + L+ L + N FSG LP G
Sbjct: 490 LDLSTNSLSGSMPQCLGNFSSMLSVLHLGMNNLQGTIPSTFSKD-NSLEYLNLNGNEIEGKISSSIINCTMLQVLDLGNNKIEDTFPYFLE---TLPKLQILVLKSNKLQGFVKGPAAYNSFSKLRILDISDNNFSGPLPTG 627

HSP 5
Score: 66.6254 bits (161), Expect = 1.16119e-11
Identity = 49/162 (30.25%), Postives = 67/162 (41.36%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+L N F G I + SL+FLD+S+N G IP F+ + + + L G I SI SG P + S+ L VL L N L G IP S ++L+ L L GN G + + C L LDL +N + P
Sbjct: 419 LDLHNNNFIGNISELQHD---SLRFLDLSNNHLRGPIPSSIFKQENLTTLILASNSKLTGEISSSICKLRFLRVLDLSTNSLSGSMPQCLGNFSSM--LSVLHLGMNNLQGTIPSTFSKDNSLEYLNLNGNEIEGKISSSIINCTMLQVLDLGNNKIEDTFP 575

HSP 6
Score: 66.2402 bits (160), Expect = 1.51656e-11
Identity = 48/164 (29.27%), Postives = 76/164 (46.34%), Query Frame = 2
Query:   17 SRNGFTGEIPTSLPNATCSLKFL---DVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNL--PVGMGLCPHLSKLDLSDNLFTGSIP 493
S + TGEI +S+ C L+FL D+S+NS SG +P L + N+LQG+IP + + G ++ ++ T L+VLDL +N + P + + L+ L L+ N+ G + P L LD+SDN F+G +P
Sbjct: 469 SNSKLTGEISSSI----CKLRFLRVLDLSTNSLSGSMPQCLGNFSSMLSVLHLGMNNLQGTIPSTFSKDNSLEYLNLNGNEIEGKI---SSSIINCTMLQVLDLGNNKIEDTFPYFLETLPKLQILVLKSNKLQGFVKGPAAYNSFSKLRILDISDNNFSGPLP 625

HSP 7
Score: 66.2402 bits (160), Expect = 1.51656e-11
Identity = 60/204 (29.41%), Postives = 84/204 (41.18%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSI--PRSITXXXXXXXXXXXXXRFSGDFPD-FAN---------------------GYVSL----------------TRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E LNL+ N G+I +S+ N T L+ LD+ +N P F E+ L+ + N LQG + P + FSG P + N GYV + +RVLDLS+N +G IPK I + L++L L N +G + +G +L LDLS NL TG IP
Sbjct: 537 EYLNLNGNEIEGKISSSIINCTM-LQVLDLGNNKIEDTFPY-FLETLPKLQILVLKSNKLQGFVKGPAAYNSFSKLRILDISDNNFSGPLPTGYFNSLEAMMASDQIMIYMRTTNYTGYVYSIEMTWKGVEIEFTKIRSTIRVLDLSNNNFTGEIPKMIGKLKALQQLNLSHNSLTGQIQSSLGNLTNLESLDLSSNLLTGRIP 738

POPTR_0081s002409.48e-2236.02%POPTR_0081s00240.1
HSP 1
Score: 100.138 bits (248), Expect = 9.47714e-22
Identity = 67/186 (36.02%), Postives = 89/186 (47.85%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+LS N F G+IP+SL N L F +SSN+FSG+IPD +F + L ++ + N G IP S+ FSG P NG+ +LT+L LDLS+N G IP + + L L L N FSG +P G L+ LDLS+N IPD F G +P
Sbjct: 121 LDLSNNRFDGQIPSSLENLN-KLDFFTLSSNNFSGKIPD-YFANLTQLTWLDLSNNRFDGQIPSSLGNLKKLYSLTLSFNNFSGKIP---NGFFNLTQLTWLDLSNNKFDGQIPSSLGNLKKLYSLTLSFNNFSGKIPNGFFNLTQLTWLDLSNN---NKIPDGFFNLTQLTWLDLLNNKFDGQIP 298

HSP 2
Score: 93.5893 bits (231), Expect = 8.87034e-20
Identity = 64/163 (39.26%), Postives = 85/163 (52.15%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L+LS N F G+IP+SL N L L +S N+FSG+IP+GFF + L ++ + N G IP S+ FSG P NG+ +LT+L LDLS+N IP G + L L L N+F G +P +G L L LS N F+G IPD
Sbjct: 169 LDLSNNRFDGQIPSSLGNLK-KLYSLTLSFNNFSGKIPNGFF-NLTQLTWLDLSNNKFDGQIPSSLGNLKKLYSLTLSFNNFSGKIP---NGFFNLTQLTWLDLSNN---NKIPDGFFNLTQLTWLDLLNNKFDGQIPSSLGNLKKLYFLTLSFNNFSGKIPD 323

HSP 3
Score: 91.2781 bits (225), Expect = 4.4023e-19
Identity = 61/162 (37.65%), Postives = 81/162 (50.00%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N F G+IP+SL N L L S N+FSG+IPDGFF + L ++ + N G I S+ F G PD G+ +LT+L LDLS+N G IP + ++ L L N FSG +P L+ LDLS N+F IP
Sbjct: 432 LDLSNNKFDGQIPSSLGNLK-KLYSLTFSFNNFSGKIPDGFF-NLTQLTWLDLSYNKFDGQISSSLRNLEKLYSLTLSFNNFFGKIPD---GFFNLTQLTWLDLSNNKFDGQIPSSLENLNKLDVFILSFNNFSGKIPDYFANLTQLTLLDLSHNMFDCKIP 588

HSP 4
Score: 90.1225 bits (222), Expect = 9.80731e-19
Identity = 61/186 (32.80%), Postives = 86/186 (46.24%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+LS N F G +P SL N L L +S+N+F+ +I + F + L ++ + N G IP S+ FSG PD+ + +LT+L LDLS+N G IP + + L L L N FSG +P G L+ LDLS+N F G IP F+G +P
Sbjct: 73 LDLSHNSFQGHLPVSLINLK-QLSHLLLSANNFTSKILNEF-SNLTQLAWLDLSNNRFDGQIPSSLENLNKLDFFTLSSNNFSGKIPDY---FANLTQLTWLDLSNNRFDGQIPSSLGNLKKLYSLTLSFNNFSGKIPNGFFNLTQLTWLDLSNNKFDGQIPSSLGNLKKLYSLTLSFNNFSGKIP 253

HSP 5
Score: 90.1225 bits (222), Expect = 9.80731e-19
Identity = 60/163 (36.81%), Postives = 81/163 (49.69%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPD--FANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSI 490
L+LS N F G+IP+SL N L L +S N+FSG+IP+GFF + L ++ + N G IP S+ FSG + G+ + T+L LDLS+N G IP + + L L N FSG +P G L+ LDLS N F G I
Sbjct: 331 LDLSNNKFDGQIPSSLGNFK-KLYSLTLSFNNFSGKIPNGFF-NLTQLTWLDLSNNKFDGQIPSSLGNLKKLYSLKLSFNNFSGKISNGKIPEGFFNFTQLTWLDLSNNKFDGQIPSSLGNLKKLYSLTFSFNNFSGKIPDGFFNLTQLTWLDLSYNKFDGQI 491

HSP 6
Score: 87.8113 bits (216), Expect = 4.86732e-18
Identity = 62/162 (38.27%), Postives = 80/162 (49.38%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L LS N F+G+IP N T L +LD+S+N+ +IPDGFF + L ++ N G IP S+ FSG PD G+ +LT L DLS+N G IP + L L L N FSG +P G L+ LDLS+N F G IP
Sbjct: 241 LTLSFNNFSGKIPNGFFNLT-QLTWLDLSNNN---KIPDGFF-NLTQLTWLDLLNNKFDGQIPSSLGNLKKLYFLTLSFNNFSGKIPD---GFFNLTWL---DLSNNKFDGQIPSSLGNFKKLYSLTLSFNNFSGKIPNGFFNLTQLTWLDLSNNKFDGQIP 391

HSP 7
Score: 81.2629 bits (199), Expect = 4.55567e-16
Identity = 64/192 (33.33%), Postives = 85/192 (44.27%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQI-----PDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLF------------------------TGSIPD 496
L+LS N F G+IP+SL N L L +S N+FSG+I P+GFF L ++ + N G IP S+ FSG PD G+ +LT+L LDLS+N G I + + L L L N F G +P G L+ LDLS+N F +G IPD
Sbjct: 379 LDLSNNKFDGQIPSSLGNLK-KLYSLKLSFNNFSGKISNGKIPEGFFNFT-QLTWLDLSNNKFDGQIPSSLGNLKKLYSLTFSFNNFSGKIPD---GFFNLTQLTWLDLSYNKFDGQISSSLRNLEKLYSLTLSFNNFFGKIPDGFFNLTQLTWLDLSNNKFDGQIPSSLENLNKLDVFILSFNNFSGKIPD 565

HSP 8
Score: 80.4925 bits (197), Expect = 7.77079e-16
Identity = 58/187 (31.02%), Postives = 84/187 (44.92%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+L L+ N G+IP SL LK+LD+ +NSF+G I F + L ++ + NS QG +P S+ F+ N + +LT+L LDLS+N G IP + ++ L L N FSG +P L+ LDLS+N F G IP F+G +P
Sbjct: 25 ELGLADNQLGGQIPFSLGKHK-QLKYLDLGNNSFTGSI--DVFANQTQLSWLDLSHNSFQGHLPVSLINLKQLSHLLLSANNFTS---KILNEFSNLTQLAWLDLSNNRFDGQIPSSLENLNKLDFFTLSSNNFSGKIPDYFANLTQLTWLDLSNNRFDGQIPSSLGNLKKLYSLTLSFNNFSGKIP 205

HSP 9
Score: 74.3294 bits (181), Expect = 5.56893e-14
Identity = 60/207 (28.99%), Postives = 88/207 (42.51%), Query Frame = 2
Query:   14 LSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFES---------------------CGSLRFVSFAGNSLQGSIPRSI-TXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPK-------GISLIH------------------NLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
LS N F+G+IP N T L LD+S N F +IP F C SL+++ F+ N L G IP S+ + +G+ ++ L L +LDLS+N SGFIP+ G+S++H NL+ L L GN+F G +P + C +L LDL +N+ + P
Sbjct: 554 LSFNNFSGKIPDYFANLT-QLTLLDLSHNMFDCKIPSSLFSMPSLQALLLHNNLLYGQISPFLCNSLQYIDFSHNRLYGQIPPSVFKNENLKALMLSSNDKLTGNI---SSVICELKFLEILDLSNNGFSGFIPQCLGNFSDGLSVLHLGGNNLRGNIPSIYSKGNNLRYLDLNGNKFKGVIPPSIINCVNLEFLDLGNNMIDDTFP 756

HSP 10
Score: 62.7734 bits (151), Expect = 1.67676e-10
Identity = 49/167 (29.34%), Postives = 73/167 (43.71%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKL---DLSDNLFTGSIP 493
E L+LS NGF+G IP L N + L L + N+ G IP + +LR++ GN +G IP SI ++ L LDL +N + P + + LK + L+ N+ G+L G + SKL DLS+N +G +P
Sbjct: 669 EILDLSNNGFSGFIPQCLGNFSDGLSVLHLGGNNLRGNIP-SIYSKGNNLRYLDLNGNKFKGVIPPSI---------------------------INCVNLEFLDLGNNMIDDTFPSFLETLPKLKVVILRSNKLHGSLK-GPTVKESFSKLQIFDLSNNNLSGPLP 806

HSP 11
Score: 56.6102 bits (135), Expect = 1.20165e-08
Identity = 53/203 (26.11%), Postives = 77/203 (37.93%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSI--PRSITXXXXXXXXXXXXXRFSGDFP-DFANGYVSLTR--------------------------------------LRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+L+ N F G IP S+ N +L+FLD+ +N P F E+ L+ V N L GS+ P SG P ++ N + ++ L LDLS N +G IP+ + + +L +L L N G + +G +L LDLS NL G IP
Sbjct: 720 LDLNGNKFKGVIPPSIINCV-NLEFLDLGNNMIDDTFPS-FLETLPKLKVVILRSNKLHGSLKGPTVKESFSKLQIFDLSNNNLSGPLPTEYFNNFKAMMSVDQDMDYMMAKNLSTSYIYSVTLAWKGSEIEFSKIQIALATLDLSCNKFTGKIPESLGKLKSLIQLNLSHNSLIGYIQPSLGNLTNLESLDLSSNLLAGRIP 920

POPTR_0019s038304.70e-2138.27%POPTR_0019s03830.1
HSP 1
Score: 97.8265 bits (242), Expect = 4.70346e-21
Identity = 62/162 (38.27%), Postives = 85/162 (52.47%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+N S N F+G +P L NAT SL+ LD + F G IP G F++ L+F+ +GN+L G IPR I F G+ P+ +LT LR LDL+ +LSG IP + + L + L N F+G +P +G L LDLSDN +G IP
Sbjct: 153 VNASSNNFSGYLPEDLGNAT-SLESLDFRGSFFEGSIP-GSFKNLQKLKFLGLSGNNLTGRIPREIGQLASLETIILGYNEFEGEIPEEIG---NLTNLRYLDLAVGSLSGQIPAELGRLKQLTTVYLYKNNFTGQIPPELGDATSLVFLDLSDNQISGEIP 309

HSP 2
Score: 89.3521 bits (220), Expect = 1.67287e-18
Identity = 59/164 (35.98%), Postives = 84/164 (51.22%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
++ + N +G IP L + L+ L++++N+ +GQIPD S SL F +GN LQ S+P SI G PD SLT +LDLS N LSG IP+ I+ L L L+ N+F+G +P + P L+ LDLS+N G IP+
Sbjct: 416 RVRMQNNLISGTIPVGLGSLPM-LQRLELANNNLTGQIPDDIGLST-SLSFFDVSGNHLQSSLPYSILSIPSLQIFMASNNNLEGQIPDQFQDCPSLT---LLDLSSNHLSGKIPESIASCEKLVNLNLKNNQFTGEIPKAISTMPTLAILDLSNNSLVGRIPE 574

HSP 3
Score: 86.2705 bits (212), Expect = 1.41617e-17
Identity = 62/185 (33.51%), Postives = 90/185 (48.65%), Query Frame = 2
Query:   14 LSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKEL------------------------KLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L +N FTG+IP L +AT SL FLD+S N SG+IP E +L+ ++ N L+G+IP + +G P+ + L+ LD+S N+LSG IP G+ NL +L ++Q N SG +PVG+G P L +L+L++N TG IPD
Sbjct: 275 LYKNNFTGQIPPELGDAT-SLVFLDLSDNQISGEIPVELAE-LKNLQLLNLMRNQLKGTIPTKLGELTKLEVLELWKNFLTGPLPENLG---QNSPLQWLDVSSNSLSGEIPPGLCHSGNLTKLILFNNSFSGPIPMSLSTCESLVRVRMQNNLISGTIPVGLGSLPMLQRLELANNNLTGQIPD 454

HSP 4
Score: 70.4774 bits (171), Expect = 8.04151e-13
Identity = 54/181 (29.83%), Postives = 81/181 (44.75%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVS------------------------SNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDN 472
++L L+ N TG+IP + +T SL F DVS +N+ GQIPD F + C SL + + N L G IP SI +F+G+ P + ++ L +LDLS+N+L G IP+ L+ L L N+ G +P G+ ++ DL N
Sbjct: 439 QRLELANNNLTGQIPDDIGLST-SLSFFDVSGNHLQSSLPYSILSIPSLQIFMASNNNLEGQIPDQF-QDCPSLTLLDLSSNHLSGKIPESIASCEKLVNLNLKNNQFTGEIPKAIS---TMPTLAILDLSNNSLVGRIPENFGNSPALETLNLSFNKLEGPVP-SNGMLTTINPNDLVGN 613

HSP 5
Score: 63.929 bits (154), Expect = 7.52663e-11
Identity = 51/163 (31.29%), Postives = 66/163 (40.49%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
LN S NGF +P L T SLK +DVS N+F G P G + G L V+ + N+ G +P D N T L LD + G IP + LK L L GN +G +P +G L + L N F G IP+
Sbjct: 105 LNFSCNGFDSSLPRELGTLT-SLKTIDVSQNNFVGSFPTGLGMASG-LTSVNASSNNFSGYLPE-----------------------DLGNA----TSLESLDFRGSFFEGSIPGSFKNLQKLKFLGLSGNNLTGRIPREIGQLASLETIILGYNEFEGEIPE 238

HSP 6
Score: 59.6918 bits (143), Expect = 1.41946e-09
Identity = 42/161 (26.09%), Postives = 68/161 (42.24%), Query Frame = 2
Query:   83 LDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
LD+S+ + +G + D + SL F++F+ N S+PR + F G FP G + L ++ S N SG++P+ + +L+ L +G+ F G++P L L LS N TG IP F G++P
Sbjct: 81 LDLSNMNLTGNVSD-HIQDLHSLSFLNFSCNGFDSSLPRELGTLTSLKTIDVSQNNFVGSFP---TGLGMASGLTSVNASSNNFSGYLPEDLGNATSLESLDFRGSFFEGSIPGSFKNLQKLKFLGLSGNNLTGRIPREIGQLASLETIILGYNEFEGEIP 237

POPTR_0039s002304.70e-2137.06%POPTR_0039s00230.1
HSP 1
Score: 97.8265 bits (242), Expect = 4.70346e-21
Identity = 63/170 (37.06%), Postives = 85/170 (50.00%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSL------TRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E L+LS N +G IP L N + +L L + N+ G I F E SL ++S N L+G IP SI + FP F L + LRVLDLS N+ +G IPK I + L++L L N F+G++ +G+ +L LDLS NLFTG IP
Sbjct: 321 EILDLSNNSLSGSIPQCLSNFSNTLSILHLGMNNLQGTISLAFSEG-NSLGYLSLNDNELEGEIPSSIINCTMLEVLDLGNNKIKDTFPHFLERLPKLQFVKIQSILRVLDLSSNSFTGEIPKLIGKLKGLQQLNLSHNYFTGHIQSSLGILTNLESLDLSSNLFTGRIP 489

HSP 2
Score: 60.4622 bits (145), Expect = 8.32166e-10
Identity = 54/166 (32.53%), Postives = 76/166 (45.78%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSI-TXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHN-LKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E L L N F G IP+ L A SL +LD+ +N F G I + F+ SL ++ + N G +P SI + +G+ + L L +LDLS+N+LSG IP+ +S N L L L N G + + L L L+DN G IP
Sbjct: 226 ESLYLFSNLFNGTIPSFL-FALPSLGYLDLHNNHFIGHISE--FQH-NSLEYLDLSNNHFHGPVPSSIFKQEYLEVLILASNNKLTGEI---SYSICKLKYLEILDLSNNSLSGSIPQCLSNFSNTLSILHLGMNNLQGTISLAFSEGNSLGYLSLNDNELEGEIP 384

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CF810502
Best 10 Hits Shown

Match Name E value Identity Description
ppa000838m 5.11e-4650.00%ppa000838m
HSP 1
Score: 180.259 bits (456), Expect = 5.114e-46
Identity = 94/188 (50.00%), Postives = 121/188 (64.36%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E LNLSRN +G +PT+L N + S+KFLD+S NS SG +PD F++C SLR++S +GN LQG +P ++ FSG+ PDFA+G SL RLR LD S+NA SG P+GIS +HNLK L LQGN FSG +P +GLCPHL ++D+S NLFTG++PD MFTGD P
Sbjct: 106 ESLNLSRNSLSGLLPTALVNMS-SIKFLDLSENSLSGPLPDNLFDNCFSLRYLSLSGNLLQGPLPSTLPRCSVLNGLNLSNNHFSGN-PDFASGIWSLKRLRTLDFSNNAFSGSAPQGISALHNLKVLLLQGNDFSGPVPADIGLCPHLGRVDISYNLFTGALPDSLQRLNSLTFFSLSDNMFTGDFP 291

HSP 2
Score: 86.6557 bits (213), Expect = 7.69522e-18
Identity = 53/163 (32.52%), Postives = 82/163 (50.31%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L+ S N F+G P + +A +LK L + N FSG +P C L V + N G++P S+ F+GDFP + +++ L+ LD S+N +G +P I + +L L L N+ G +P+ + C LS + LSDN F+GSIP+
Sbjct: 207 LDFSNNAFSGSAPQGI-SALHNLKVLLLQGNDFSGPVPADI-GLCPHLGRVDISYNLFTGALPDSLQRLNSLTFFSLSDNMFTGDFPQWIG---NMSSLKYLDFSNNGFTGSLPASIGDLKSLSYLSLSNNKLVGAIPLSLAYCNALSVIRLSDNSFSGSIPE 364

HSP 3
Score: 80.4925 bits (197), Expect = 5.51477e-16
Identity = 60/190 (31.58%), Postives = 87/190 (45.79%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPD--GFFESCGSLRFVSFAGNSLQ------------------------GSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E+++ S+ G TG IP SLK LD+S N+ G IP G F + LR+++ + N+LQ GSIP I +G P N + + L ++ LSHN LSG IPK IS ++ LK LKL+ N SG +P +G +L +++S N G +P
Sbjct: 372 EEIHFSQMGLTGSIPPGSSRLFESLKMLDLSRNNLKGNIPAEVGLFSN---LRYLNLSWNNLQSRMPPELGFFQNLTVLDLRNSALFGSIPGDICDSGSLGILQLDGNSLNGPIP---NEIGNCSSLYLMSLSHNNLSGLIPKSISKLNKLKILKLEYNELSGEIPQELGRLENLLAVNISYNRLVGRLP 555

HSP 4
Score: 73.9442 bits (180), Expect = 5.16167e-14
Identity = 57/163 (34.97%), Postives = 77/163 (47.24%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCS-LKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N G IP SL A C+ L + +S NSFSG IP+G F+ L + F+ L GSIP P + + S L++LDLS N L G IP + L NL+ L L N +P +G +L+ LDL ++ GSIP
Sbjct: 327 LSLSNNKLVGAIPLSL--AYCNALSVIRLSDNSFSGSIPEGLFDL--GLEEIHFSQMGLTGSIP-----------------------PGSSRLFES---LKMLDLSRNNLKGNIPAEVGLFSNLRYLNLSWNNLQSRMPPELGFFQNLTVLDLRNSALFGSIP 459

HSP 5
Score: 66.2402 bits (160), Expect = 1.07627e-11
Identity = 47/140 (33.57%), Postives = 65/140 (46.43%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVG 427
LNLS N +P L +L LD+ +++ G IP +S GSL + GNSL G IP I SG P + L +L++L L +N LSG IP+ + + NL + + NR G LPVG
Sbjct: 423 LNLSWNNLQSRMPPEL-GFFQNLTVLDLRNSALFGSIPGDICDS-GSLGILQLDGNSLNGPIPNEIGNCSSLYLMSLSHNNLSGLIPKSIS---KLNKLKILKLEYNELSGEIPQELGRLENLLAVNISYNRLVGRLPVG 557

ppa000904m 8.76e-3039.78%ppa000904m
HSP 1
Score: 126.331 bits (316), Expect = 8.76372e-30
Identity = 74/186 (39.78%), Postives = 101/186 (54.30%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+L+ N FTG I LP+ SL+ +D+S NS SG IPD FF CGSLR VSFA N+L G IP+S++ + SG P +G L L+ LDLS N L G +P+G+ +++L+ + + N FSG LP +G C L LD S+N F+GSIP+ F G +P
Sbjct: 96 LSLANNNFTGTINPDLPHLG-SLQVIDLSQNSLSGPIPDEFFMQCGSLRVVSFARNNLTGQIPQSLSICQTLVAVNFSSNQLSGKLP---SGIWYLRGLQALDLSDNLLEGEVPEGMENLYDLRVINFRKNWFSGKLPWDIGSCLLLKLLDFSENFFSGSIPESIQRLSSCSSLSLQGNSFAGQIP 277

HSP 2
Score: 88.9669 bits (219), Expect = 1.55053e-18
Identity = 61/188 (32.45%), Postives = 84/188 (44.68%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
EKLNLSRN FTG +P SL N L +DVS N +G++P F+ ++ VS +GN L GS ++ + S L+VLDLS N S +P I ++ L+ L + GN G++P +G S +DLSDN GSIP TG +P
Sbjct: 311 EKLNLSRNEFTGSLPESLTNCI-KLLAIDVSHNLLAGKLPSWIFKL--GIQSVSLSGNRLSGS----------------------AEYSSLTSMEASNGGLQVLDLSSNEFSDVLPSDIGVLSRLQFLNMSGNHLLGSIPASIGKLKTASVVDLSDNQLNGSIPSEIGGVVSLKELRLQKNFLTGKIP 473

ppa000889m 1.14e-2937.97%ppa000889m
HSP 1
Score: 125.946 bits (315), Expect = 1.14458e-29
Identity = 71/187 (37.97%), Postives = 102/187 (54.55%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
KL+LS+N TG + ++ + +L+ LD+S NSFSG +P+ FF CGSLR +S A N + G IP S+ +FSG P G SL +R LDLS+N L G I K I ++NL+ + L NRF+G +P G+G C L +DLS+N F+G++P F G++P
Sbjct: 97 KLSLSKNNLTGSLTPNIAHID-NLRALDLSENSFSGPVPEDFFRQCGSLRTISLAKNKISGKIPESLGSCASLAAIDLSLNQFSGSVPV---GIWSLNGIRSLDLSNNLLEGEISKAIGGLNNLRAVNLGKNRFTGQVPDGIGSCLLLRSIDLSENSFSGNLPQTMQKFSLCSYLNLHQNSFAGEIP 279

HSP 2
Score: 87.4261 bits (215), Expect = 4.51136e-18
Identity = 53/162 (32.72%), Postives = 79/162 (48.77%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N GEI ++ +L+ +++ N F+GQ+PDG SC LR + + NS G++P+++ F+G+ P++ L L LDLS N G +P I + LK L N F+G+LP M C L LD S N G +P
Sbjct: 195 LDLSNNLLEGEISKAIGGLN-NLRAVNLGKNRFTGQVPDGI-GSCLLLRSIDLSENSFSGNLPQTMQKFSLCSYLNLHQNSFAGEIPEWIG---ELKSLETLDLSGNRFLGEVPSSIGNLQALKVLNFSANGFTGSLPKSMAYCTSLVALDFSKNSMAGELP 351

HSP 3
Score: 85.8853 bits (211), Expect = 1.31261e-17
Identity = 65/194 (33.51%), Postives = 93/194 (47.94%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLT------RLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E L+LS N F GE+P+S+ N +LK L+ S+N F+G +P C SL + F+ NS+ G +P I + SG AN VS + L+V+DLS N SG I I ++ +L+ L L GN G +PV +G L +DLS+N +GSIP + TG +P
Sbjct: 289 ETLDLSGNRFLGEVPSSIGNLQ-ALKVLNFSANGFTGSLPKSM-AYCTSLVALDFSKNSMAGELPAWI-FKAGLEEVSLSEKKLSGS----ANSPVSSSIGNAPQNLQVVDLSLNQFSGEIASDIGVLSSLRSLNLSGNSLVGPIPVTIGELKALDNVDLSENRLSGSIPLEIGGAFSLKELRLENNLLTGKIP 475

HSP 4
Score: 75.485 bits (184), Expect = 1.77404e-14
Identity = 63/212 (29.72%), Postives = 85/212 (40.09%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXX-----RFSGDFPDFANGYVSLTRLRV---------------------LDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
LN S NGFTG +P S+ T SL LD S NS +G++P F++ L VS + L GS ++ +FSG+ SL L + +DLS N LSG IP I +LKEL+L+ N +G +P +G C L+ L S N G +P TG LP
Sbjct: 315 LNFSANGFTGSLPKSMAYCT-SLVALDFSKNSMAGELPAWIFKA--GLEEVSLSEKKLSGSANSPVSSSIGNAPQNLQVVDLSLNQFSGEIASDIGVLSSLRSLNLSGNSLVGPIPVTIGELKALDNVDLSENRLSGSIPLEIGGAFSLKELRLENNLLTGKIPTSIGNCSSLTTLIASQNRLNGPVPAAMAKLTNLQNVDLSFNNLTGGLP 523

HSP 5
Score: 63.1586 bits (152), Expect = 9.1112e-11
Identity = 48/143 (33.57%), Postives = 64/143 (44.76%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIP---DGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVG 427
LNLS N G IP ++ +L +D+S N SG IP G F SL+ + N L G IP SI R +G P LT L+ +DLS N L+G +PK ++ + NL + N G LP G
Sbjct: 415 LNLSGNSLVGPIPVTIGELK-ALDNVDLSENRLSGSIPLEIGGAF----SLKELRLENNLLTGKIPTSIGNCSSLTTLIASQNRLNGPVPA---AMAKLTNLQNVDLSFNNLTGGLPKQLANLPNLLSFNISHNNLQGELPAG 549

ppa016276m 2.56e-2137.04%ppa016276m
HSP 1
Score: 98.2117 bits (243), Expect = 2.55577e-21
Identity = 60/162 (37.04%), Postives = 88/162 (54.32%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N F+G+IPT L N + L+ LD+ N FSG+IP+ FF + +L +V N L GSIP ++ +FSG P + ++L L L+ N L G +PK ++ + NL L + N G++P+G G C +L LD S N F+G IP
Sbjct: 97 LDLSVNKFSGKIPTELANCSL-LENLDLYENGFSGEIPESFF-AIPALAYVHLYSNRLNGSIPGNVGNLSELVHLDLYENQFSGVIPSSVG---NCSKLEDLYLAENQLIGELPKSLNKLENLVYLDVANNSLEGSIPLGSGTCKNLIYLDFSYNKFSGGIP 253

HSP 2
Score: 82.0333 bits (201), Expect = 1.8954e-16
Identity = 60/188 (31.91%), Postives = 83/188 (44.15%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E L L+ N GE+P SL N +L +LDV++NS G IP G +C +L ++ F+ N G IP + G P + + L L +L L N LSG IP + +LKEL L N+ G +P +G+ L L L +N TG IP TG+LP
Sbjct: 191 EDLYLAENQLIGELPKSL-NKLENLVYLDVANNSLEGSIPLGS-GTCKNLIYLDFSYNKFSGGIPPGLGNCSNLTQFSAVGSNLEGTIP---SSFGQLKYLSILYLPLNHLSGKIPPELGKCESLKELHLYTNQLVGEIPGELGMLTQLQDLKLFENRLTGEIPVSIWKIQSLQHILVYNNSLTGELP 373

HSP 3
Score: 77.411 bits (189), Expect = 4.66853e-15
Identity = 64/208 (30.77%), Postives = 88/208 (42.31%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATC-SLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPD-------------FANGYVS--------LTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+++ N G IP L + TC +L +LD S N FSG IP G +C +L S G++L+G+IP S SG P + N V LT+L+ L L N L+G IP I I +L+ + + N +G LPV M L + L +NLF G IP FTG +P
Sbjct: 217 LDVANNSLEGSIP--LGSGTCKNLIYLDFSYNKFSGGIPPGL-GNCSNLTQFSAVGSNLEGTIPSSFGQLKYLSILYLPLNHLSGKIPPELGKCESLKELHLYTNQLVGEIPGELGMLTQLQDLKLFENRLTGEIPVSIWKIQSLQHILVYNNSLTGELPVVMTELKQLKNISLFNNLFFGVIPQTLGINSSLWLLDFTNNKFTGKIP 421

HSP 4
Score: 77.411 bits (189), Expect = 4.66853e-15
Identity = 56/163 (34.36%), Postives = 79/163 (48.47%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L L +N G +P L T KF DV SN +G IP S L + + NS G IPR T F+G P VSL+ L+LS+NAL+G IP + + +L++L L N +G L + L+++D+SDN FTGS+P+
Sbjct: 528 LILFKNNLVGPLPPQLSKCTKMDKF-DVGSNLLNGSIPSSL-RSWTDLSTLILSDNSFTGEIPRFFTEFEKLIELRLGGNLFAGAIPSSIGALVSLSY--ALNLSNNALTGRIPSELGKLTSLQQLDLSHNNLTGTLKA-LDHMISLTEVDVSDNNFTGSVPE 685

HSP 5
Score: 76.6406 bits (187), Expect = 7.96331e-15
Identity = 53/164 (32.32%), Postives = 77/164 (46.95%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E L+L NGF+GEIP S A +L ++ + SN +G IP G + L + N G IP S+ + G+ P N L L LD+++N+L G IP G NL L N+FSG +P G+G C +L++ + G+IP
Sbjct: 119 ENLDLYENGFSGEIPESF-FAIPALAYVHLYSNRLNGSIP-GNVGNLSELVHLDLYENQFSGVIPSSVGNCSKLEDLYLAENQLIGELPKSLN---KLENLVYLDVANNSLEGSIPLGSGTCKNLIYLDFSYNKFSGGIPPGLGNCSNLTQFSAVGSNLEGTIP 277

HSP 6
Score: 73.559 bits (179), Expect = 6.74134e-14
Identity = 56/185 (30.27%), Postives = 83/185 (44.86%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP----------------DFANGYV-----SLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLS-KLDLSDNLFTGSIP 493
+L L N TG +P N+ L ++D+S+N SG+IP +C +L ++ + N L G IP+ + G P + NG + S T L L LS N+ +G IP+ + L EL+L GN F+G +P +G LS L+LS+N TG IP
Sbjct: 456 RLKLGHNNLTGVLPQFAKNSR--LLYMDISNNEISGEIPS-ILGNCSNLTTINLSINKLTGGIPQELGNLEELRSLILFKNNLVGPLPPQLSKCTKMDKFDVGSNLLNGSIPSSLRSWTDLSTLILSDNSFTGEIPRFFTEFEKLIELRLGGNLFAGAIPSSIGALVSLSYALNLSNNALTGRIP 637

HSP 7
Score: 70.4774 bits (171), Expect = 5.70689e-13
Identity = 55/212 (25.94%), Postives = 84/212 (39.62%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMG------------------------LCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+ ++L N F G IP +L SL LD ++N F+G+IP L ++ N +QG+IP + +G P FA +RL +D+S+N +SG IP + NL + L N+ +G +P +G C + K D+ NL GSIP FTG++P
Sbjct: 383 KNISLFNNLFFGVIPQTL-GINSSLWLLDFTNNKFTGKIPPSLCRG-KQLWKLNMGFNRIQGTIPSDVGNCSSLSRLKLGHNNLTGVLPQFAKN----SRLLYMDISNNEISGEIPSILGNCSNLTTINLSINKLTGGIPQELGNLEELRSLILFKNNLVGPLPPQLSKCTKMDKFDVGSNLLNGSIPSSLRSWTDLSTLILSDNSFTGEIP 588

HSP 8
Score: 67.781 bits (164), Expect = 3.6991e-12
Identity = 51/162 (31.48%), Postives = 70/162 (43.21%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLK-ELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSI 490
+NLS N TG IP L N L+ L + N+ G +P C + N L GSIP S+ F+G+ P F + L LR L N +G IP I + +L L L N +G +P +G L +LDLS N TG++
Sbjct: 504 INLSINKLTGGIPQELGNLE-ELRSLILFKNNLVGPLPPQL-SKCTKMDKFDVGSNLLNGSIPSSLRSWTDLSTLILSDNSFTGEIPRFFTEFEKLIELR---LGGNLFAGAIPSSIGALVSLSYALNLSNNALTGRIPSELGKLTSLQQLDLSHNNLTGTL 660

HSP 9
Score: 54.299 bits (129), Expect = 4.23231e-08
Identity = 50/186 (26.88%), Postives = 74/186 (39.78%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L L N +G+IP L SLK L + +N G+IP G L+ + N L G IP SI +G+ P L +L+ + L +N G IP+ + + +L L N+F+G +P + L KL++ N G+IP TG LP
Sbjct: 289 LYLPLNHLSGKIPPELGKCE-SLKELHLYTNQLVGEIP-GELGMLTQLQDLKLFENRLTGEIPVSIWKIQSLQHILVYNNSLTGELPVVMT---ELKQLKNISLFNNLFFGVIPQTLGINSSLWLLDFTNNKFTGKIPPSLCRGKQLWKLNMGFNRIQGTIPSDVGNCSSLSRLKLGHNNLTGVLP 469

ppa001042m 5.69e-2136.59%ppa001042m
HSP 1
Score: 97.0561 bits (240), Expect = 5.69367e-21
Identity = 60/164 (36.59%), Postives = 81/164 (49.39%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
+L L N FTG+IP+ L L FL++S N F+G+IP +C L V GN LQG IP S + LT L VLDLS N + G IP+ + + +L +L + GN +G++P +G C L LD+S N TGSIPD
Sbjct: 448 RLRLGSNNFTGQIPSEL-RLLHRLTFLELSENQFNGEIPPEI-GNCTQLEMVDLHGNELQGMIPSS---------------------------FQFLTGLNVLDLSMNMIEGTIPENLGNLTSLNKLVISGNHITGSIPKSLGFCKDLQLLDMSSNNITGSIPD 582

HSP 2
Score: 81.2629 bits (199), Expect = 3.23306e-16
Identity = 62/198 (31.31%), Postives = 84/198 (42.42%), Query Frame = 2
Query:   14 LSRNGFTGEIPTSLPNATC------SLKFLDV-------SSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP-DFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L +N TG IP +L N + S+ L V S N SG IP F + SL+ + N G IP I + G P + AN +L+ LDLSHN L+G +P + + NL +L L N+ SG LP +G C +L +L L N FTG IP F G++P
Sbjct: 293 LWKNNLTGSIPGALGNCSLLIVIDFSMNLLSVALEEFLLSENHISGSIPP-LFGNFSSLKQLELDNNRFTGKIPPVIGKLKELTLFFAWQNQLHGSIPTELAN----CEKLQALDLSHNLLNGSVPSSLFDLKNLTQLLLISNQLSGVLPTNIGNCTNLIRLRLGSNNFTGQIPSELRLLHRLTFLELSENQFNGEIP 485

HSP 3
Score: 75.0998 bits (183), Expect = 2.31697e-14
Identity = 60/211 (28.44%), Postives = 86/211 (40.76%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDG---------FFE--------------SCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E+ LS N +G IP N + SLK L++ +N F+G+IP FF +C L+ + + N L GS+P S+ + SG P +L RLR L N +G IP + L+H L L+L N+F+G +P +G C L +DL N G IP M G +P
Sbjct: 327 EEFLLSENHISGSIPPLFGNFS-SLKQLELDNNRFTGKIPPVIGKLKELTLFFAWQNQLHGSIPTELANCEKLQALDLSHNLLNGSVPSSLFDLKNLTQLLLISNQLSGVLPTNIGNCTNLIRLR---LGSNNFTGQIPSELRLLHRLTFLELSENQFNGEIPPEIGNCTQLEMVDLHGNELQGMIPSSFQFLTGLNVLDLSMNMIEGTIP 533

HSP 4
Score: 59.6918 bits (143), Expect = 1.00736e-09
Identity = 40/121 (33.06%), Postives = 54/121 (44.63%), Query Frame = 2
Query:  140 CGSLRFVS---FAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
C S RFVS ++ S P + SG+ P SLT LDLS NAL+G IP+ I + L+ L L N G +P +G C L +L+L DN +G +P
Sbjct: 65 CSSSRFVSEITITSLNVPTSFPSQLLSFNYLTTLVISKGNLSGEIPPSIGNLSSLT---TLDLSFNALTGKIPQEIGKLSKLQLLSLNSNSLHGVIPKEIGNCSQLQQLELYDNQLSGKVP 182

HSP 5
Score: 57.7658 bits (138), Expect = 3.82797e-09
Identity = 50/202 (24.75%), Postives = 77/202 (38.12%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLD--------------LSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
++L L N +G++P + + F + G+IP +C +L F+ A + G IP SI +G P + + L L L N LSG IP S + L+ + L N +G++P +G C L +D LS+N +GSIP FTG +P
Sbjct: 168 QQLELYDNQLSGKVPAEIGQLSALEIFRAGGNPGIHGEIPMQI-SNCKALTFLGLAATGITGQIPSSIGQLENLQTLSVYTANLTGAIPPEIG---NCSALENLFLYENQLSGHIPGEFSRLKRLRRVLLWKNNLTGSIPGALGNCSLLIVIDFSMNLLSVALEEFLLSENHISGSIPPLFGNFSSLKQLELDNNRFTGKIP 365

HSP 6
Score: 56.9954 bits (136), Expect = 6.52952e-09
Identity = 46/139 (33.09%), Postives = 64/139 (46.04%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLP 421
KL +S N TG IP SL L+ LD+SSN+ +G IPD G ++ + NSL IP S + +L++L +DLSHN L+G + K + + NL L + N FSG LP
Sbjct: 544 KLVISGNHITGSIPKSLGFCK-DLQLLDMSSNNITGSIPDEIGRLQGLDILLNLSWNSLTSPIPES---------------------------FSNLSKLANMDLSHNMLTGSL-KVLGSLDNLVSLNVSYNDFSGPLP 653

ppa001349m 1.66e-2037.06%ppa001349m
HSP 1
Score: 95.5153 bits (236), Expect = 1.6566e-20
Identity = 63/170 (37.06%), Postives = 90/170 (52.94%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGS-------LRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+LNLS N F+G +P S ++ SL FL + N+ SG +PD + S G+ L+ ++ N L GSIP S+ FSG P N SL+RLR LD S+NA++G +P IS + L +L L+GN+ +P G+G +LS L+L N G IP
Sbjct: 208 RLNLSYNSFSGSVPVSFTHSH-SLTFLALQHNNLSGPVPDSW-GSTGTQNSHLFRLQSLTLDHNFLSGSIPASLGKLSELEEVSISGNHFSGAIP---NEIGSLSRLRTLDFSNNAINGSLPSSISNLSLLVQLNLEGNKLDSKIPEGLGSLKNLSVLNLRKNQLQGPIP 372

HSP 2
Score: 85.8853 bits (211), Expect = 1.31261e-17
Identity = 56/164 (34.15%), Postives = 80/164 (48.78%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+ L L N +G IP SL + L+ + +S N FSG IP+ S LR + F+ N++ GS+P SI+ + P+ G SL L VL+L N L G IP + I L +L L N S +P + PHLS L++SDN +G +P
Sbjct: 262 QSLTLDHNFLSGSIPASLGKLS-ELEEVSISGNHFSGAIPNEI-GSLSRLRTLDFSNNAINGSLPSSISNLSLLVQLNLEGNKLDSKIPE---GLGSLKNLSVLNLRKNQLQGPIPAALGNISTLTQLDLSLNNLSDGIPASLADLPHLSFLNVSDNNLSGPVP 420

HSP 3
Score: 70.4774 bits (171), Expect = 5.70689e-13
Identity = 54/170 (31.76%), Postives = 80/170 (47.06%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYV-----SLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
+ L+LS N T +IP SL N+T L L++S NSFSG +P F S SL F++ N+L G +P S + D +F +G + L+ L + +S N SG IP I + L+ L N +G+LP + L +L+L N IP+
Sbjct: 183 QTLDLSNNSLTDKIPDSLANST-KLYRLNLSYNSFSGSVPVSFTHS-HSLTFLALQHNNLSGPVPDSWGSTGTQNSHLFRLQSLTLDH-NFLSGSIPASLGKLSELEEVSISGNHFSGAIPNEIGSLSRLRTLDFSNNAINGSLPSSISNLSLLVQLNLEGNKLDSKIPE 349

HSP 4
Score: 56.6102 bits (135), Expect = 8.52782e-09
Identity = 30/88 (34.09%), Postives = 44/88 (50.00%), Query Frame = 2
Query:  302 LRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
LR L L N + G IP+ + + +L+ ++L NR SG++P +G P L LDLS+N T IPD F+G +P
Sbjct: 134 LRKLSLHDNQIEGPIPQSLGFLPSLRGVQLFNNRLSGSIPPSLGFSPLLQTLDLSNNSLTDKIPDSLANSTKLYRLNLSYNSFSGSVP 221

HSP 5
Score: 55.8398 bits (133), Expect = 1.45463e-08
Identity = 39/117 (33.33%), Postives = 58/117 (49.57%), Query Frame = 2
Query:  146 SLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
+LR +S N ++G IP+S+ R SG P + G+ L L+ LDLS+N+L+ IP ++ L L L N FSG++PV L+ L L N +G +PD
Sbjct: 133 ALRKLSLHDNQIEGPIPQSLGFLPSLRGVQLFNNRLSGSIPP-SLGFSPL--LQTLDLSNNSLTDKIPDSLANSTKLYRLNLSYNSFSGSVPVSFTHSHSLTFLALQHNNLSGPVPD 246

ppa016834m 2.83e-2034.15%ppa016834m
HSP 1
Score: 94.7449 bits (234), Expect = 2.82574e-20
Identity = 56/164 (34.15%), Postives = 86/164 (52.44%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+ ++L N F G +P NAT FL++ SN FSG IP F + L+ + + N L G+IP SI FSG+FP + + S + ++++D+++N L G IP + ++ +L LKL N F G +P + C L +DL DN +GSIP
Sbjct: 529 DTISLDHNQFKGPLPLWSTNAT----FLNLESNLFSGPIPSNFDKLMPKLKEMYLSENHLNGTIPPSICNMQDLRLISLRSNHFSGEFP---HAWSSESHIQIVDVAYNNLFGNIPTSMGVLTSLVILKLNNNNFGGKIPDSLHNCSVLKSIDLGDNKLSGSIP 685

HSP 2
Score: 77.411 bits (189), Expect = 4.66853e-15
Identity = 56/166 (33.73%), Postives = 85/166 (51.20%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGI--SLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+++ LS N G IP S+ N L+ + + SN FSG+ P + S ++ V A N+L G+IP S+ F G PD + + + L+ +DL N LSG IP I S + L L+L+ N F+G +P+ + +L LDLS N F+G+IP
Sbjct: 575 KEMYLSENHLNGTIPPSICNMQ-DLRLISLRSNHFSGEFPHAW-SSESHIQIVDVAYNNLFGNIPTSMGVLTSLVILKLNNNNFGGKIPDSLH---NCSVLKSIDLGDNKLSGSIPPWIGGSNVSMLYMLRLRSNFFTGQIPIQLCNLGNLHILDLSHNNFSGAIP 735

HSP 3
Score: 62.7734 bits (151), Expect = 1.18996e-10
Identity = 56/194 (28.87%), Postives = 75/194 (38.66%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFV-SFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRL-------------------------------RVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L L+ N F G+IP SL N + LK +D+ N SG IP S S+ ++ N G IP + FSG P N SL + + +DLS N L G IP+ I + L L L N+ + N+P +G L LDLS N +G IP
Sbjct: 649 LKLNNNNFGGKIPDSLHNCSV-LKSIDLGDNKLSGSIPPWIGGSNVSMLYMLRLRSNFFTGQIPIQLCNLGNLHILDLSHNNFSGAIPKCFNHLTSLINVSYGTSEYVDEEPTMLTLKGQELVYNTTLMLVKSIDLSSNFLEGEIPQEICSLTLLGTLNLSRNQLTSNIPSIVGSMHMLETLDLSHNHLSGHIP 841

HSP 4
Score: 62.3882 bits (150), Expect = 1.55413e-10
Identity = 52/176 (29.55%), Postives = 71/176 (40.34%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFE-------SCGSLRFVS--------------------------FAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGL 436
L L N FTG+IP L N +L LD+S N+FSG IP F S G+ +V + N L+G IP+ I + + + P S+ L LDLSHN LSG IP+ ++ + L L L N G +P+G L
Sbjct: 699 LRLRSNFFTGQIPIQLCNLG-NLHILDLSHNNFSGAIPKCFNHLTSLINVSYGTSEYVDEEPTMLTLKGQELVYNTTLMLVKSIDLSSNFLEGEIPQEICSLTLLGTLNLSRNQLTSNIPSIVG---SMHMLETLDLSHNHLSGHIPQSLASLTFLSHLNLSYNNLVGRIPLGSQL 870

HSP 5
Score: 54.6842 bits (130), Expect = 3.24057e-08
Identity = 49/173 (28.32%), Postives = 78/173 (45.09%), Query Frame = 2
Query:    8 LNLSRNGF-TGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQG----SIPRSITXXXXXXXXXXXXXRFSGD-----FPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L+LS N F T P+ + N T SLK LD++SNSF F + G+L+ + + S G +PR + FSG + +N + L LDLS L G +P + ++ +L+ L L N+ +G++P +G L L L + G+I +
Sbjct: 257 LDLSANDFNTSSFPSWIFNLT-SLKRLDLNSNSFDAH----FLDELGNLKSLEYLDLSSSGLKDSGVPRVLGNLCKLKTLNLEWNNFSGGGIEEFWGSLSNCPNNTLVLESLDLSSCGLEGQLPASLGMLKSLQYLYLYDNQMNGSIPQSLGQLSELIDLALYGKSWEGNITE 424

ppa001194m 1.07e-1934.76%ppa001194m
HSP 1
Score: 92.8189 bits (229), Expect = 1.07378e-19
Identity = 57/164 (34.76%), Postives = 83/164 (50.61%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
K+N S N +G IP + + S++ LD+S N F+G+IP F+ C +FVS + N L GSIP S+ SG P + RL L L NALSG + + +S +LK L L N F G+ P G+ +L+ ++S N+F G IP+
Sbjct: 124 KINFSSNALSGSIPEFIGDLP-SIRLLDLSRNGFTGEIPSALFKHCYKTKFVSLSHNILLGSIPESLANCLNLEGFDFSFNNLSGGIP---LRICDIPRLDYLSLRSNALSGDVVQQLSTCQSLKLLDLGSNLFKGSAPFGVLGSSNLTYFNVSHNVFNGKIPE 283

HSP 2
Score: 78.9518 bits (193), Expect = 1.60455e-15
Identity = 54/164 (32.93%), Postives = 80/164 (48.78%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E + S N GE+P S+ N SLK L++ N SG IP+ + L + NS+ G+IP+++ GD PD + + L R LD+S NAL G IP+ + + L+ L L N+ +G++P +G L LDLS N +G IP
Sbjct: 292 EYFDASWNELEGELPLSITNCR-SLKVLELGYNRLSGSIPE-VLGNLDRLLVIQLCNNSISGTIPKNLASIQLLQVLDLHNLSLVGDIPDDISNCMFL---RELDVSGNALEGEIPQNLYNMTYLEILDLHKNQLNGSIPPDLGNLSKLQYLDLSQNSLSGLIP 450

HSP 3
Score: 78.5666 bits (192), Expect = 2.09561e-15
Identity = 52/163 (31.90%), Postives = 82/163 (50.31%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGS-LRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+L N F G P + ++ +L + +VS N F+G+IP+ +C + + + N L+G +P SIT R SG P+ +L RL V+ L +N++SG IPK ++ I L+ L L G++P + C L +LD+S N G IP
Sbjct: 246 LDLGSNLFKGSAPFGVLGSS-NLTYFNVSHNVFNGKIPE--IATCSERMEYFDASWNELEGELPLSITNCRSLKVLELGYNRLSGSIPEVLG---NLDRLLVIQLCNNSISGTIPKNLASIQLLQVLDLHNLSLVGDIPDDISNCMFLRELDVSGNALEGEIP 402

HSP 4
Score: 70.8626 bits (172), Expect = 4.36961e-13
Identity = 53/167 (31.74%), Postives = 77/167 (46.11%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATC-SLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTR---LRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L+L N +G++ L +TC SLK LD+ SN F G P G S +L + + + N G IP T G+ P +S+T L+VL+L +N LSG IP+ + + L ++L N SG +P + L LDL + G IPD
Sbjct: 222 LSLRSNALSGDVVQQL--STCQSLKLLDLGSNLFKGSAPFGVLGS-SNLTYFNVSHNVFNGKIPEIATCSERMEYFDASWNELEGELP------LSITNCRSLKVLELGYNRLSGSIPEVLGNLDRLLVIQLCNNSISGTIPKNLASIQLLQVLDLHNLSLVGDIPD 379

HSP 5
Score: 70.4774 bits (171), Expect = 5.70689e-13
Identity = 45/142 (31.69%), Postives = 71/142 (50.00%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP-DFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGM 430
+ L N +G IP +L + L+ LD+ + S G IPD +C LR + +GN+L+G IP+++ + +G P D N L++L+ LDLS N+LSG IP + + L L N+ SG +P +
Sbjct: 342 IQLCNNSISGTIPKNLASIQL-LQVLDLHNLSLVGDIPDDI-SNCMFLRELDVSGNALEGEIPQNLYNMTYLEILDLHKNQLNGSIPPDLGN----LSKLQYLDLSQNSLSGLIPSSLGNLTKLTYFNLSSNKLSGTIPTAI 477

HSP 6
Score: 65.4698 bits (158), Expect = 1.83584e-11
Identity = 54/186 (29.03%), Postives = 75/186 (40.32%), Query Frame = 2
Query:   74 LKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPD------FANGYVSLT----------------RLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+ L + NSF G IP+ + + +L ++F+ N+L GSIP I F+G+ P + +VSL+ L D S N LSG IP I I L L L+ N SG++ + C L LDL NLF GS P +F G +P
Sbjct: 98 LRVLTLFGNSFMGNIPNEYAD-IQTLWKINFSSNALSGSIPEFIGDLPSIRLLDLSRNGFTGEIPSALFKHCYKTKFVSLSHNILLGSIPESLANCLNLEGFDFSFNNLSGGIPLRICDIPRLDYLSLRSNALSGDVVQQLSTCQSLKLLDLGSNLFKGSAPFGVLGSSNLTYFNVSHNVFNGKIP 282

HSP 7
Score: 54.6842 bits (130), Expect = 3.24057e-08
Identity = 38/133 (28.57%), Postives = 54/133 (40.60%), Query Frame = 2
Query:   98 NSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGI-SLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
NS G + LR ++ GNS G+IP SG P+F L +R+LDLS N +G IP + + K + L N G++P + C +L D S N +G IP
Sbjct: 81 NSSLGGVLSPALSGLKYLRVLTLFGNSFMGNIPNEYADIQTLWKINFSSNALSGSIPEFIG---DLPSIRLLDLSRNGFTGEIPSALFKHCYKTKFVSLSHNILLGSIPESLANCLNLEGFDFSFNNLSGGIP 210

ppa025228m 1.07e-1937.65%ppa025228m
HSP 1
Score: 92.8189 bits (229), Expect = 1.07378e-19
Identity = 61/162 (37.65%), Postives = 83/162 (51.23%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
LNLS+N TG IP + N + SL LD+S N G P+ F C SL+F+ GN L G + + + SG+ PD N L L +LDLS+NA SG IP I + ++ LKL+ N F+G LP + C L +DL +N +G IP
Sbjct: 172 LNLSKNNLTGLIPDVIGNMS-SLASLDLSDNQIEGGNPNSFARLC-SLQFLDIPGNRLSGQLSNATSLTFLNLSSNSV----SGELPDCWN---KLENLVMLDLSNNAFSGKIPTTIGSLFKIETLKLRNNSFAGELPSSLKNCTSLEVIDLGNNKLSGPIP 324

HSP 2
Score: 75.485 bits (184), Expect = 1.77404e-14
Identity = 56/163 (34.36%), Postives = 84/163 (51.53%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISL-IHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L++ N +G+ L NAT SL FL++SSNS SG++PD + +L + + N+ G IP +I F+G+ P + + T L V+DL +N LSG IP + + NL L L N F+G++P + H+ LD S N +GSIP
Sbjct: 220 LDIPGNRLSGQ----LSNAT-SLTFLNLSSNSVSGELPD-CWNKLENLVMLDLSNNAFSGKIPTTIGSLFKIETLKLRNNSFAGELP---SSLKNCTSLEVIDLGNNKLSGPIPTWLGVSFKNLVILMLSFNNFNGSMPPQLCHLVHVQILDFSMNNISGSIP 373

HSP 3
Score: 68.1662 bits (165), Expect = 2.8323e-12
Identity = 55/211 (26.07%), Postives = 81/211 (38.39%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTR-----------------------------------------------LRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E L L N F GE+P+SL N T SL+ +D+ +N SG IP S +L + + N+ GS+P + SG P N +L++ ++ +DLS N L+G IP I+ + L L L N+ +G + +G L LDLS N +G IP
Sbjct: 286 ETLKLRNNSFAGELPSSLKNCT-SLEVIDLGNNKLSGPIPTWLGVSFKNLVILMLSFNNFNGSMPPQLCHLVHVQILDFSMNNISGSIPKCLNNLTALSQKGNSSLTSTHYYRKENDKIVFPGNSYEDDATFIWKGRMSTYKSILGLVKRIDLSSNRLTGEIPSEITYLVELVSLNLSRNQLTGQITPEIGNLQSLDSLDLSRNRISGRIP 495

ppa017871m 1.83e-1935.37%ppa017871m
HSP 1
Score: 92.0485 bits (227), Expect = 1.83159e-19
Identity = 58/164 (35.37%), Postives = 88/164 (53.66%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+ L+LS N F+G+IP L N + L+ LD+ N FSG IP+ F + +L +V N+L GSIP ++ +FSG P + ++L+ L L N L+G +P ++ + NL L + N G++P+G G C +L LDLS N F+G IP
Sbjct: 98 QTLDLSVNNFSGKIPKELANCSL-LENLDLYKNGFSGAIPESLF-AIPALAYVHLYTNNLNGSIPGNVGNLSELVHLYLYENQFSGVIPSSIG---NCSKLQELFLGRNQLTGELPMSLNNLQNLVYLDVAINSLEGSIPLGSGTCKNLIYLDLSYNKFSGGIP 256

HSP 2
Score: 77.411 bits (189), Expect = 4.66853e-15
Identity = 61/211 (28.91%), Postives = 91/211 (43.13%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPN----------------------ATC-SLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
++L L RN TGE+P SL N TC +L +LD+S N FSG IP G +C +L S G++L+G+IP S SG P S L++L L N L G IP + ++ L++L+L NR +G +PV + L + + +N TG +P+ +F G +P
Sbjct: 194 QELFLGRNQLTGELPMSLNNLQNLVYLDVAINSLEGSIPLGSGTCKNLIYLDLSYNKFSGGIPPGL-GNCSNLTQFSAVGSNLEGTIPSSFGQLKYLSTLYLPLNHLSGKIPPELGKCES---LKILRLYKNQLVGEIPSELGMLTQLEDLELFENRLTGEIPVSIWKIQSLQHILVYNNSLTGELPEVMTELKQLKNISLYNNLFFGVIP 400

HSP 3
Score: 72.4034 bits (176), Expect = 1.50181e-13
Identity = 61/212 (28.77%), Postives = 83/212 (39.15%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMG------------------LCPHLS------KLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+ ++L N F G IP SL SL LD +N F+G+IP LR ++ N QG+IP + R G P FA + L +D+S+N +SG IP + NL + L N +G +P +G L PHLS K D+ NL GSIP FTG +P
Sbjct: 386 KNISLYNNLFFGVIPQSL-GINSSLWQLDFINNKFTGKIPPNLCHG-KQLRVLNLGFNRFQGTIPSDVGNCSTLWRLKLEQNRLIGALPQFAKN----SSLSYMDISNNEISGEIPSSLGNCSNLTAINLSMNNLTGVIPQELGSLAELGSLILFKNNLVGPLPPHLSNCTKMYKFDVGSNLLNGSIPSSLRSWTGLSTLILSDNSFTGGVP 591

HSP 4
Score: 70.4774 bits (171), Expect = 5.70689e-13
Identity = 46/163 (28.22%), Postives = 75/163 (46.01%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+L L +N G +P N+ SL ++D+S+N SG+IP +C +L ++ + N+L G IP+ + G P + + T++ D+ N L+G IP + L L L N F+G +P + LS+L L N G+IP
Sbjct: 459 RLKLEQNRLIGALPQFAKNS--SLSYMDISNNEISGEIPSSL-GNCSNLTAINLSMNNLTGVIPQELGSLAELGSLILFKNNLVGPLPPHLS---NCTKMYKFDVGSNLLNGSIPSSLRSWTGLSTLILSDNSFTGGVPPFLSEFEKLSELQLGGNFLGGAIP 615

HSP 5
Score: 69.707 bits (169), Expect = 9.73448e-13
Identity = 51/163 (31.29%), Postives = 74/163 (45.40%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L L +N G +P L N T KF DV SN +G IP S L + + NS G +P ++ G P VS+ L+LS+NAL+G IP + + L+ L L N +G L + L ++D+SDN FTG++P+
Sbjct: 531 LILFKNNLVGPLPPHLSNCTKMYKF-DVGSNLLNGSIPSSL-RSWTGLSTLILSDNSFTGGVPPFLSEFEKLSELQLGGNFLGGAIPSSIGALVSM--FYALNLSNNALTGPIPSELGKLARLQRLDLSHNNLTGTLKA-LDYINSLIEVDVSDNNFTGAVPE 688

HSP 6
Score: 67.3958 bits (163), Expect = 4.83117e-12
Identity = 50/162 (30.86%), Postives = 71/162 (43.83%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGI-SLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSI 490
+NLS N TG IP L + L L + N+ G +P +C + N L GSIP S+ F+G P F + + L+ L+ L N L G IP I +L+ L L N +G +P +G L +LDLS N TG++
Sbjct: 507 INLSMNNLTGVIPQEL-GSLAELGSLILFKNNLVGPLPP-HLSNCTKMYKFDVGSNLLNGSIPSSLRSWTGLSTLILSDNSFTGGVPPFLSEFEKLSELQ---LGGNFLGGAIPSSIGALVSMFYALNLSNNALTGPIPSELGKLARLQRLDLSHNNLTGTL 663

HSP 7
Score: 65.4698 bits (158), Expect = 1.83584e-11
Identity = 50/162 (30.86%), Postives = 73/162 (45.06%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L L +N GEIP+ L T L+ L++ N +G+IP ++ SL+ + NSL G +P +T F G P SL +L D +N +G IP + L+ L L NRF G +P +G C L +L L N G++P
Sbjct: 316 LRLYKNQLVGEIPSELGMLT-QLEDLELFENRLTGEIPVSIWK-IQSLQHILVYNNSLTGELPEVMTELKQLKNISLYNNLFFGVIPQSLGINSSLWQL---DFINNKFTGKIPPNLCHGKQLRVLNLGFNRFQGTIPSDVGNCSTLWRLKLEQNRLIGALP 472

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CF810502
Best 10 Hits Shown

Match Name E value Identity Description
Y3804_ARATH3.17e-3845.21%
Probably inactive leucine-rich repeat re...
HSP 1
Score: 157.918 bits (398), Expect = 3.16788e-38
Identity = 85/188 (45.21%), Postives = 116/188 (61.70%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+KL+LS N +G+IP+SL + T SL+ LD++ NSFSG + D F +C SLR++S + N L+G IP ++ RFSG+ P F +G L RLR LDLS N+LSG IP GI +HNLKEL+LQ N+FSG LP +GLCPHL+++DLS N F+G +P + +GD P
Sbjct: 127 QKLDLSHNNLSGQIPSSLGSIT-SLQHLDLTGNSFSGTLSDDLFNNCSSLRYLSLSHNHLEGQIPSTLFRCSVLNSLNLSRNRFSGN-PSFVSGIWRLERLRALDLSSNSLSGSIPLGILSLHNLKELQLQRNQFSGALPSDIGLCPHLNRVDLSSNHFSGELPRTLQKLKSLNHFDVSNNLLSGDFP 312

HSP 2
Score: 91.2781 bits (225), Expect = 3.64137e-18
Identity = 64/184 (34.78%), Postives = 86/184 (46.74%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPR-SITXXXXXXXXXXXXXRFSGDFPDFANGYVS---------------------LTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
LNLS N +GE+P SL + L + + N FSG IPDGFF+ L+ + F+GN L GSIPR S +G P ++ L L VLDL ++AL G +P I +L+ L+L GN +G++P G+G C L L LS N TG IP
Sbjct: 348 LNLSENKLSGEVPESLESCK-ELMIVQLKGNDFSGNIPDGFFDL--GLQEMDFSGNGLTGSIPRGSSRLFESLIRLDLSHNSLTGSIPGEVGLFIHMRYLNLSWNHFNTRVPPEIEFLQNLTVLDLRNSALIGSVPADICESQSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIP 528

HSP 3
Score: 86.2705 bits (212), Expect = 1.17139e-16
Identity = 55/163 (33.74%), Postives = 79/163 (48.47%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L+LS N +G IP + + +LK L + N FSG +P C L V + N G +PR++ SGDFP + +T L LD S N L+G +P IS + +LK+L L N+ SG +P + C L + L N F+G+IPD
Sbjct: 228 LDLSSNSLSGSIPLGILSLH-NLKELQLQRNQFSGALPSDI-GLCPHLNRVDLSSNHFSGELPRTLQKLKSLNHFDVSNNLLSGDFPPWIG---DMTGLVHLDFSSNELTGKLPSSISNLRSLKDLNLSENKLSGEVPESLESCKELMIVQLKGNDFSGNIPD 385

HSP 4
Score: 77.7962 bits (190), Expect = 4.16626e-14
Identity = 50/163 (30.67%), Postives = 84/163 (51.53%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+L+LS N TG IP + +++L++S N F+ ++P E +L + ++L GS+P I +G P+ G + + L++L LSHN L+G IPK +S + LK LKL+ N+ SG +P +G +L +++S N G +P
Sbjct: 419 RLDLSHNSLTGSIPGEV-GLFIHMRYLNLSWNHFNTRVPPEI-EFLQNLTVLDLRNSALIGSVPADICESQSLQILQLDGNSLTGSIPE---GIGNCSSLKLLSLSHNNLTGPIPKSLSNLQELKILKLEANKLSGEIPKELGDLQNLLLVNVSFNRLIGRLP 576

HSP 5
Score: 63.929 bits (154), Expect = 6.22566e-10
Identity = 46/140 (32.86%), Postives = 66/140 (47.14%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVG 427
LNLS N F +P + +L LD+ +++ G +P ES SL+ + GNSL GSIP I +G P + +L L++L L N LSG IPK + + NL + + NR G LP+G
Sbjct: 444 LNLSWNHFNTRVPPEIEFLQ-NLTVLDLRNSALIGSVPADICES-QSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIPKSLS---NLQELKILKLEANKLSGEIPKELGDLQNLLLVNVSFNRLIGRLPLG 578

HSP 6
Score: 56.6102 bits (135), Expect = 9.93942e-08
Identity = 41/113 (36.28%), Postives = 51/113 (45.13%), Query Frame = 2
Query:  158 VSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGM-GLCPHLSKLDLSDNLFTGSIP 493
+S G +L G I R I F+G+ +N L+ LDLSHN LSG IP + I +L+ L L GN FSG L + C L L LS N G IP
Sbjct: 82 LSLDGLALTGKINRGIQKLQRLKVLSLSNNNFTGNINALSNN----NHLQKLDLSHNNLSGQIPSSLGSITSLQHLDLTGNSFSGTLSDDLFNNCSSLRYLSLSHNHLEGQIP 190

BRI1_ARATH1.34e-2039.02%
Protein BRASSINOSTEROID INSENSITIVE 1 OS...
HSP 1
Score: 99.3673 bits (246), Expect = 1.33714e-20
Identity = 64/164 (39.02%), Postives = 86/164 (52.44%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++L L NGFTG+IP +L N + L L +S N SG IP S LR + N L+G IP+ + +G+ P +G + T L + LS+N L+G IPK I + NL LKL N FSGN+P +G C L LDL+ NLF G+IP
Sbjct: 419 QELYLQNNGFTGKIPPTLSNCS-ELVSLHLSFNYLSGTIPSSL-GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIP---SGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIP 577

HSP 2
Score: 85.5001 bits (210), Expect = 1.99809e-16
Identity = 64/193 (33.16%), Postives = 89/193 (46.11%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPR-SITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLR----VLDLSHNALSGFIPKGI--SLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+L+ N FTGEIP L A +L LD+S N F G +P FF SC L ++ + N+ G +P ++ FSG+ P+ SLT L LDLS N SG I + + + L+EL LQ N F+G +P + C L L LS N +G+IP M G++P
Sbjct: 296 LSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPP-FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE------SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 481

HSP 3
Score: 77.411 bits (189), Expect = 5.44131e-14
Identity = 58/211 (27.49%), Postives = 90/211 (42.65%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXR--FSGDFP----------------DFANGYV-----SLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E L LS N F+GE+P LK LD+S N FSG++P+ SL + + N+ G I ++ F+G P ++ +G + SL++LR L L N L G IP+ + + L+ L L N +G +P G+ C +L+ + LS+N TG IP F+G++P
Sbjct: 343 ESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIP 553

HSP 4
Score: 66.6254 bits (161), Expect = 9.60481e-11
Identity = 56/191 (29.32%), Postives = 83/191 (43.46%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCS-LKFLDVSSNS--FSGQIPDGF-------------------------FESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L+LSRN +G + T +CS LKFL+VSSN+ F G++ G + CG L+ ++ +GN + G + ++ FS P + + L+ LD+S N LSG + IS LK L + N+F G +P L L L++N FTG IPD
Sbjct: 127 LDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDV--DVSRCVNLEFLDVSSNNFSTGIPFLGD----CSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLP--LKSLQYLSLAENKFTGEIPD 309

Y4361_ARATH6.64e-2038.41%
Probable LRR receptor-like serine/threon...
HSP 1
Score: 97.0561 bits (240), Expect = 6.63613e-20
Identity = 63/164 (38.41%), Postives = 91/164 (55.49%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+ L++S N F+GEIP + N L+ L +++NS +G+IP + CGSL + F GNSL+G IP + FSG P + V+L +L L+L N L+G P + + +L EL L GNRFSG +PV + +LS L+LS N F+G IP
Sbjct: 335 KNLDVSGNLFSGEIPPDIGNLK-RLEELKLANNSLTGEIPVE-IKQCGSLDVLDFEGNSLKGQIPEFLGYMKALKVLSLGRNSFSGYVP---SSMVNLQQLERLNLGENNLNGSFPVELMALTSLSELDLSGNRFSGAVPVSISNLSNLSFLNLSGNGFSGEIP 493

HSP 2
Score: 93.9745 bits (232), Expect = 5.61782e-19
Identity = 61/164 (37.20%), Postives = 80/164 (48.78%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E+L L+ N TGEIP + SL LD NS GQIP+ F +L+ +S NS G +P S+ +G FP ++LT L LDLS N SG +P IS + NL L L GN FSG +P +G L+ LDLS +G +P
Sbjct: 359 EELKLANNSLTGEIPVEIKQCG-SLDVLDFEGNSLKGQIPE-FLGYMKALKVLSLGRNSFSGYVPSSMVNLQQLERLNLGENNLNGSFPV---ELMALTSLSELDLSGNRFSGAVPVSISNLSNLSFLNLSGNGFSGEIPASVGNLFKLTALDLSKQNMSGEVP 517

HSP 3
Score: 92.0485 bits (227), Expect = 2.13477e-18
Identity = 58/164 (35.37%), Postives = 80/164 (48.78%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E+LNL N G P L T SL LD+S N FSG +P + +L F++ +GN G IP S+ SG+ P +G L ++V+ L N SG +P+G S + +L+ + L N FSG +P G L L LSDN +GSIP
Sbjct: 431 ERLNLGENNLNGSFPVELMALT-SLSELDLSGNRFSGAVPVSI-SNLSNLSFLNLSGNGFSGEIPASVGNLFKLTALDLSKQNMSGEVPVELSG---LPNVQVIALQGNNFSGVVPEGFSSLVSLRYVNLSSNSFSGEIPQTFGFLRLLVSLSLSDNHISGSIP 589

HSP 4
Score: 87.0409 bits (214), Expect = 6.86732e-17
Identity = 62/163 (38.04%), Postives = 82/163 (50.31%), Query Frame = 2
Query:   14 LSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFV---SFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L N F+G +P ++ SL+++++SSNSFSG+IP F G LR + S + N + GSIP I R G P + L RL+VLDL N LSG IP IS +L L L N SG +P +L+K+DLS N TG IP
Sbjct: 531 LQGNNFSGVVPEGF-SSLVSLRYVNLSSNSFSGEIPQTF----GFLRLLVSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLMGHIPADLS---RLPRLKVLDLGQNNLSGEIPPEISQSSSLNSLSLDHNHLSGVIPGSFSGLSNLTKMDLSVNNLTGEIP 685

HSP 5
Score: 83.9593 bits (206), Expect = 5.81354e-16
Identity = 54/162 (33.33%), Postives = 84/162 (51.85%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+L RN F+G +P+S+ N L+ L++ N+ +G P + SL + +GN G++P SI+ FSG+ P +L +L LDLS +SG +P +S + N++ + LQGN FSG +P G L ++LS N F+G IP
Sbjct: 409 LSLGRNSFSGYVPSSMVNLQ-QLERLNLGENNLNGSFPVELM-ALTSLSELDLSGNRFSGAVPVSISNLSNLSFLNLSGNGFSGEIPASVG---NLFKLTALDLSKQNMSGEVPVELSGLPNVQVIALQGNNFSGVVPEGFSSLVSLRYVNLSSNSFSGEIP 565

HSP 6
Score: 83.1889 bits (204), Expect = 9.91639e-16
Identity = 56/164 (34.15%), Postives = 78/164 (47.56%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E N++ N +GEIP LP+ SL+FLD+SSN+FSGQIP G + L+ ++ + N L G IP S+ +L L+ L L N L G +P IS +L L N G +P G P L L LS+N F+G++P
Sbjct: 143 EVFNVAGNRLSGEIPVGLPS---SLQFLDISSNTFSGQIPSG-LANLTQLQLLNLSYNQLTGEIPASLG---------------------------NLQSLQYLWLDFNLLQGTLPSAISNCSSLVHLSASENEIGGVIPAAYGALPKLEVLSLSNNNFSGTVP 275

HSP 7
Score: 81.6481 bits (200), Expect = 2.88523e-15
Identity = 62/185 (33.51%), Postives = 85/185 (45.95%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPD--FANGYVSL---------------------TRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
LNLS N TGEIP SL N SL++L + N G +P +C SL +S + N + G IP + FSG P F N +++ T L+VLDL N +SG P ++ I +LK L + GN FSG +P +G L +L L++N TG IP
Sbjct: 191 LNLSYNQLTGEIPASLGNLQ-SLQYLWLDFNLLQGTLPSAI-SNCSSLVHLSASENEIGGVIPAAYGALPKLEVLSLSNNNFSGTVPFSLFCNTSLTIVQLGFNAFSDIVRPETTANCRTGLQVLDLQENRISGRFPLWLTNILSLKNLDVSGNLFSGEIPPDIGNLKRLEELKLANNSLTGEIP 373

HSP 8
Score: 80.8777 bits (198), Expect = 4.92145e-15
Identity = 58/163 (35.58%), Postives = 79/163 (48.47%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
KL+L N F G IPTSL T L + NS SG++P + SL + AGN L G IP + FSG P +G +LT+L++L+LS+N L+G IP + + +L+ L L N G LP + C L L S+N G IP
Sbjct: 96 KLSLRSNSFNGTIPTSLAYCTRLLSVF-LQYNSLSGKLPPA-MRNLTSLEVFNVAGNRLSGEIP--VGLPSSLQFLDISSNTFSGQIP---SGLANLTQLQLLNLSYNQLTGEIPASLGNLQSLQYLWLDFNLLQGTLPSAISNCSSLVHLSASENEIGGVIP 251

HSP 9
Score: 69.3218 bits (168), Expect = 1.48181e-11
Identity = 57/188 (30.32%), Postives = 78/188 (41.49%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXX--RFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+ S N G IP + A L+ L +S+N+FSG +P F + SL V N+ + T R SG FP + +SL L D+S N SG IP I + L+ELKL N +G +PV + C L LD N G IP+ F+G +P
Sbjct: 239 LSASENEIGGVIPAAY-GALPKLEVLSLSNNNFSGTVPFSLFCNT-SLTIVQLGFNAFSDIVRPETTANCRTGLQVLDLQENRISGRFPLWLTNILSLKNL---DVSGNLFSGEIPPDIGNLKRLEELKLANNSLTGEIPVEIKQCGSLDVLDFEGNSLKGQIPEFLGYMKALKVLSLGRNSFSGYVP 421

BRI1_SOLPE2.52e-1933.33%
Systemin receptor SR160 OS=Solanum peruv...
HSP 1
Score: 95.1301 bits (235), Expect = 2.52173e-19
Identity = 63/189 (33.33%), Postives = 88/189 (46.56%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIP-RSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGI--SLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L L N F G P L + ++ LD+S N+FSG +P+ E C SL V + N+ G +P ++ +F G PD + +L +L LD+S N L+G IP GI ++NLK L LQ N F G +P + C L LDLS N TGSIP +G++P
Sbjct: 308 LYLRGNDFQGVYPNQLADLCKTVVELDLSYNNFSGMVPESLGE-CSSLELVDISNNNFSGKLPVDTLLKLSNIKTMVLSFNKFVGGLPD---SFSNLPKLETLDMSSNNLTGIIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIP 492

HSP 2
Score: 85.8853 bits (211), Expect = 1.52988e-16
Identity = 62/186 (33.33%), Postives = 86/186 (46.24%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSL-PNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP--------------DFAN-------GYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E L++S N TG IP+ + + +LK L + +N F G IPD +C L + + N L GSIP S+ + SG+ P DF + + T+L + LS+N LSG IP + + NL LKL N SGN+P +G C L LDL+ N GSIP
Sbjct: 404 ETLDMSSNNLTGIIPSGICKDPMNNLKVLYLQNNLFKGPIPDSL-SNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPASLGRLSNLAILKLGNNSISGNIPAELGNCQSLIWLDLNTNFLNGSIP 588

HSP 3
Score: 71.633 bits (174), Expect = 2.98574e-12
Identity = 54/166 (32.53%), Postives = 80/166 (48.19%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXR-FSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISL-IHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+ L+LS N F G+I +SL + L FL++++N F G +P ES L+++ GN QG P + FSG P+ + L ++D+S+N SG +P L + N+K + L N+F G LP P L LD+S N TG IP
Sbjct: 260 QHLDLSSNKFYGDIGSSLSSCG-KLSFLNLTNNQFVGLVPKLPSES---LQYLYLRGNDFQGVYPNQLADLCKTVVELDLSYNNFSGMVPESLG---ECSSLELVDISNNNFSGKLPVDTLLKLSNIKTMVLSFNKFVGGLPDSFSNLPKLETLDMSSNNLTGIIP 418

HSP 4
Score: 69.3218 bits (168), Expect = 1.48181e-11
Identity = 55/166 (33.13%), Postives = 79/166 (47.59%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCS-LKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRV-LDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGL-CPHLSKLDLSDNLFTGSIPD 496
L+LS N F+ P+ CS L+ LD+SSN F G I SCG L F++ N G +P+ + F G +P N L + V LDLS+N SG +P+ + +L+ + + N FSG LPV L ++ + LS N F G +PD
Sbjct: 239 LDLSANNFSTVFPSF---KDCSNLQHLDLSSNKFYGDIGSSL-SSCGKLSFLNLTNNQFVGLVPKLPSESLQYLYLRGND--FQGVYP---NQLADLCKTVVELDLSYNNFSGMVPESLGECSSLELVDISNNNFSGKLPVDTLLKLSNIKTMVLSFNKFVGGLPD 395

HSP 5
Score: 65.0846 bits (157), Expect = 2.79457e-10
Identity = 64/211 (30.33%), Postives = 86/211 (40.76%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCG--SLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP--------------------DFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMG-LCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+ LNLS+N L AT SL+ LD+S N+ SG + S G L F S GN L GSIP FS FP D + S +L L+L++N G +PK S +L+ L L+GN F G P + LC + +LDLS N F+G +P+ F+G LP
Sbjct: 163 KSLNLSKNFLDPPGKEMLKGATFSLQVLDLSYNNISGFNLFPWVSSMGFVELEFFSIKGNKLAGSIPE--LDFKNLSYLDLSANNFSTVFPSFKDCSNLQHLDLSSNKFYGDIGSSLSSCGKLSFLNLTNNQFVGLVPKLPS--ESLQYLYLRGNDFQGVYPNQLADLCKTVVELDLSYNNFSGMVPESLGECSSLELVDISNNNFSGKLP 369

BRI1_SOLLC4.30e-1933.33%
Brassinosteroid LRR receptor kinase OS=S...
HSP 1
Score: 94.3597 bits (233), Expect = 4.30142e-19
Identity = 63/189 (33.33%), Postives = 89/189 (47.09%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIP-RSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGI--SLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L L N F G P L + ++ LD+S N+FSG +P+ E C SL V + N+ G +P +++ +F G PD + +L +L LD+S N L+G IP GI ++NLK L LQ N F G +P + C L LDLS N TGSIP +G++P
Sbjct: 308 LYLRGNDFQGVYPNQLADLCKTVVELDLSYNNFSGMVPESLGE-CSSLELVDISYNNFSGKLPVDTLSKLSNIKTMVLSFNKFVGGLPD---SFSNLLKLETLDMSSNNLTGVIPSGICKDPMNNLKVLYLQNNLFKGPIPDSLSNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIP 492

HSP 2
Score: 86.2705 bits (212), Expect = 1.17139e-16
Identity = 62/186 (33.33%), Postives = 86/186 (46.24%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSL-PNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP--------------DFAN-------GYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E L++S N TG IP+ + + +LK L + +N F G IPD +C L + + N L GSIP S+ + SG+ P DF + + T+L + LS+N LSG IP + + NL LKL N SGN+P +G C L LDL+ N GSIP
Sbjct: 404 ETLDMSSNNLTGVIPSGICKDPMNNLKVLYLQNNLFKGPIPDSL-SNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIPASLGRLSNLAILKLGNNSISGNIPAELGNCQSLIWLDLNTNFLNGSIP 588

HSP 3
Score: 69.3218 bits (168), Expect = 1.48181e-11
Identity = 53/166 (31.93%), Postives = 80/166 (48.19%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXR-FSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKG-ISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+ L+LS N F G+I +SL + L FL++++N F G +P ES L+++ GN QG P + FSG P+ + L ++D+S+N SG +P +S + N+K + L N+F G LP L LD+S N TG IP
Sbjct: 260 QHLDLSSNKFYGDIGSSLSSCG-KLSFLNLTNNQFVGLVPKLPSES---LQYLYLRGNDFQGVYPNQLADLCKTVVELDLSYNNFSGMVPESLG---ECSSLELVDISYNNFSGKLPVDTLSKLSNIKTMVLSFNKFVGGLPDSFSNLLKLETLDMSSNNLTGVIP 418

HSP 4
Score: 68.5514 bits (166), Expect = 2.52758e-11
Identity = 54/166 (32.53%), Postives = 79/166 (47.59%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCS-LKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRV-LDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVG-MGLCPHLSKLDLSDNLFTGSIPD 496
L+LS N F+ P+ CS L+ LD+SSN F G I SCG L F++ N G +P+ + F G +P N L + V LDLS+N SG +P+ + +L+ + + N FSG LPV + ++ + LS N F G +PD
Sbjct: 239 LDLSANNFSTVFPSF---KDCSNLQHLDLSSNKFYGDIGSSL-SSCGKLSFLNLTNNQFVGLVPKLPSESLQYLYLRGND--FQGVYP---NQLADLCKTVVELDLSYNNFSGMVPESLGECSSLELVDISYNNFSGKLPVDTLSKLSNIKTMVLSFNKFVGGLPD 395

HSP 5
Score: 64.3142 bits (155), Expect = 4.76682e-10
Identity = 64/211 (30.33%), Postives = 86/211 (40.76%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCG--SLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP--------------------DFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMG-LCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+ LNLS+N L AT SL+ LD+S N+ SG + S G L F S GN L GSIP FS FP D + S +L L+L++N G +PK S +L+ L L+GN F G P + LC + +LDLS N F+G +P+ F+G LP
Sbjct: 163 KSLNLSKNFLDPPGKEMLKAATFSLQVLDLSYNNISGFNLFPWVSSMGFVELEFFSLKGNKLAGSIPE--LDFKNLSYLDLSANNFSTVFPSFKDCSNLQHLDLSSNKFYGDIGSSLSSCGKLSFLNLTNNQFVGLVPKLPS--ESLQYLYLRGNDFQGVYPNQLADLCKTVVELDLSYNNFSGMVPESLGECSSLELVDISYNNFSGKLP 369

Y5694_ARATH5.62e-1934.15%
Probably inactive leucine-rich repeat re...
HSP 1
Score: 93.9745 bits (232), Expect = 5.61782e-19
Identity = 56/164 (34.15%), Postives = 84/164 (51.22%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFA--GNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N +GEIP SL + +L LDVS N SG P G C R ++ + N +GS+P SI FSG+FP L R++++ +N +G +P+ +SL L+++++ N FSG +P G+GL L K S N F+G +P
Sbjct: 249 LDLSLNNLSGEIPRSLGPSLKNLVSLDVSQNKLSGSFPSGI---CSGKRLINLSLHSNFFEGSLPNSIGECLSLERLQVQNNGFSGEFPVVL---WKLPRIKIIRADNNRFTGQVPESVSLASALEQVEIVNNSFSGEIPHGLGLVKSLYKFSASQNRFSGELP 406

HSP 2
Score: 83.1889 bits (204), Expect = 9.91639e-16
Identity = 56/165 (33.94%), Postives = 80/165 (48.48%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP-DFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E+L + NGF+GE P L +K + +N F+GQ+P+ +L V NS G IP + RFSG+ P +F + V L ++++SHN L G IP+ + L L L GN F+G +P + L+ LDLSDN TG IP
Sbjct: 320 ERLQVQNNGFSGEFPVVLWKLP-RIKIIRADNNRFTGQVPESV-SLASALEQVEIVNNSFSGEIPHGLGLVKSLYKFSASQNRFSGELPPNFCDSPV----LSIVNISHNRLLGKIPE-LKNCKKLVSLSLAGNAFTGEIPPSLADLHVLTYLDLSDNSLTGLIP 477

HSP 3
Score: 80.1073 bits (196), Expect = 8.39473e-15
Identity = 58/188 (30.85%), Postives = 82/188 (43.62%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E+L L R+GF GEIPTS T SL+ LD+S N+ SG+IP S +L + + N L GS P +G S RL L L N G +P I +L+ L++Q N FSG PV + P + + +N FTG +P+ F+G++P
Sbjct: 223 EQLLLHRSGFHGEIPTSFVGLT-SLRTLDLSLNNLSGEIPRSLGPSLKNLVSLDVSQNKLSGSFP---------------------------SGICSGKRLINLSLHSNFFEGSLPNSIGECLSLERLQVQNNGFSGEFPVVLWKLPRIKIIRADNNRFTGQVPESVSLASALEQVEIVNNSFSGEIP 382

HSP 4
Score: 57.3806 bits (137), Expect = 5.82704e-08
Identity = 45/140 (32.14%), Postives = 64/140 (45.71%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLP 421
E++ + N F+GEIP L KF S N FSG++P F +S L V+ + N L G IP + F+G+ P L L LDLS N+L+G IP+G+ + L + N SG +P
Sbjct: 368 EQVEIVNNSFSGEIPHGLGLVKSLYKF-SASQNRFSGELPPNFCDS-PVLSIVNISHNRLLGKIPE-LKNCKKLVSLSLAGNAFTGEIPP---SLADLHVLTYLDLSDNSLTGLIPQGLQNL-KLALFNVSFNGLSGEVP 500

RLK5_ARATH7.34e-1937.30%
Receptor-like protein kinase 5 OS=Arabid...
HSP 1
Score: 93.5893 bits (231), Expect = 7.33711e-19
Identity = 69/185 (37.30%), Postives = 88/185 (47.57%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP-----------------DFAN----GYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E L L N F+GEI +L SL + +S+N SGQIP GF+ L + + NS GSIP++I RFSG P DF+ V L +L LDLS N LSG IP+ + NL EL L N SG +P +G+ P L+ LDLS N F+G IP
Sbjct: 382 EYLILIDNSFSGEISNNLGKCK-SLTRVRLSNNKLSGQIPHGFW-GLPRLSLLELSDNSFTGSIPKTIIGAKNLSNLRISKNRFSGSIPNEIGSLNGIIEISGAENDFSGEIPESLVKLKQLSRLDLSKNQLSGEIPRELRGWKNLNELNLANNHLSGEIPKEVGILPVLNYLDLSSNQFSGEIP 564

HSP 2
Score: 87.0409 bits (214), Expect = 6.86732e-17
Identity = 64/209 (30.62%), Postives = 91/209 (43.54%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANG-----YVSLT----------------RLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E++ L N F+GE+P S+ N T +LK D S N +G+IPD + +L ++ N L+G +P SIT R +G P YV L+ +L L L N+ SG I + +L ++L N+ SG +P G P LS L+LSDN FTGSIP F+G +P
Sbjct: 263 EQIELFNNSFSGELPESMGNMT-TLKRFDASMNKLTGKIPDNL--NLLNLESLNLFENMLEGPLPESITRSKTLSELKLFNNRLTGVLPSQLGANSPLQYVDLSYNRFSGEIPANVCGEGKLEYLILIDNSFSGEISNNLGKCKSLTRVRLSNNKLSGQIPHGFWGLPRLSLLELSDNSFTGSIPKTIIGAKNLSNLRISKNRFSGSIP 468

HSP 3
Score: 86.6557 bits (213), Expect = 8.969e-17
Identity = 56/187 (29.95%), Postives = 90/187 (48.13%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+L L N TG +P+ L A L+++D+S N FSG+IP G L ++ NS G I ++ + SG P +G+ L RL +L+LS N+ +G IPK I NL L++ NRFSG++P +G + ++ ++N F+G IP+ +G++P
Sbjct: 335 ELKLFNNRLTGVLPSQL-GANSPLQYVDLSYNRFSGEIPANVCGE-GKLEYLILIDNSFSGEISNNLGKCKSLTRVRLSNNKLSGQIP---HGFWGLPRLSLLELSDNSFTGSIPKTIIGAKNLSNLRISKNRFSGSIPNEIGSLNGIIEISGAENDFSGEIPESLVKLKQLSRLDLSKNQLSGEIP 516

HSP 4
Score: 85.1149 bits (209), Expect = 2.60958e-16
Identity = 63/185 (34.05%), Postives = 87/185 (47.03%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFS--------GDFPDFANGYVS--------------LTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L+LS N G IP SLP +LKFL++S N+ S IP F E L ++ AGN L G+IP S+ FS G+ + +++ LT L LDL+ N L+G IP I+ + +++++L N FSG LP MG L + D S N TG IPD
Sbjct: 119 LDLSENLLVGSIPKSLPFNLPNLKFLEISGNNLSDTIPSSFGEF-RKLESLNLAGNFLSGTIPASLGNVTTLKELKLAYNLFSPSQIPSQLGNLTELQVLWLAGCNLVGPIPPSLSRLTSLVNLDLTFNQLTGSIPSWITQLKTVEQIELFNNSFSGELPESMGNMTTLKRFDASMNKLTGKIPD 302

HSP 5
Score: 79.337 bits (194), Expect = 1.43192e-14
Identity = 57/162 (35.19%), Postives = 82/162 (50.62%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L LS N FTG IP ++ A +L L +S N FSG IP+ G + +S A N G IP S+ + SG+ P G+ +L L +L++N LSG IPK + ++ L L L N+FSG +P+ + L+ L+LS N +G IP
Sbjct: 432 LELSDNSFTGSIPKTIIGAK-NLSNLRISKNRFSGSIPNEIGSLNGIIE-ISGAENDFSGEIPESLVKLKQLSRLDLSKNQLSGEIPRELRGWKNLNEL---NLANNHLSGEIPKEVGILPVLNYLDLSSNQFSGEIPLELQNL-KLNVLNLSYNHLSGKIP 587

HSP 6
Score: 72.4034 bits (176), Expect = 1.75041e-12
Identity = 52/153 (33.99%), Postives = 71/153 (46.41%), Query Frame = 2
Query:   35 GEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
G IP SL T SL LD++ N +G IP + ++ + NS G +P S+ + +G PD N L L L+L N L G +P+ I+ L ELKL NR +G LP +G L +DLS N F+G IP
Sbjct: 226 GPIPPSLSRLT-SLVNLDLTFNQLTGSIPS-WITQLKTVEQIELFNNSFSGELPESMGNMTTLKRFDASMNKLTGKIPDNLN----LLNLESLNLFENMLEGPLPESITRSKTLSELKLFNNRLTGVLPSQLGANSPLQYVDLSYNRFSGEIP 372

GSO2_ARATH9.58e-1932.45%
LRR receptor-like serine/threonine-prote...
HSP 1
Score: 93.2041 bits (230), Expect = 9.58256e-19
Identity = 61/188 (32.45%), Postives = 92/188 (48.94%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFE-----------------------SCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP-DFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++L LS +GEIP + N SLK LD+S+N+ +GQIPD F+ + +L+ + N+L+G +P+ I RFSG+ P + N TRL+ +D N LSG IP I + +L L L+ N GN+P +G C ++ +DL+DN +GSIP
Sbjct: 340 KQLFLSETQLSGEIPAEISNCQ-SLKLLDLSNNTLTGQIPDSLFQLVELTNLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGEMPVEIGN----CTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGNCHQMTVIDLADNQLSGSIP 522

HSP 2
Score: 85.1149 bits (209), Expect = 2.60958e-16
Identity = 53/164 (32.32%), Postives = 81/164 (49.39%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E L L++N +G +P ++ + SLK L +S SG+IP +C SL+ + + N+L G IP S+ G ++ +LT L+ L HN L G +PK I + L+ + L NRFSG +PV +G C L ++D N +G IP
Sbjct: 315 EFLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIP-AEISNCQSLKLLDLSNNTLTGQIPDSLFQLVELTNLYLNNNSLEG---TLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGEMPVEIGNCTRLQEIDWYGNRLSGEIP 474

HSP 3
Score: 79.7221 bits (195), Expect = 1.09639e-14
Identity = 54/166 (32.53%), Postives = 78/166 (46.99%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSF--AGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E + N G +P SL N +L ++ SSN F+G I CGS ++SF N +G IP + +F+G P + ++ L +LD+S N+LSG IP + L L + L N SG +P +G P L +L LS N F GS+P
Sbjct: 532 ELFMIYNNSLQGNLPDSLINLK-NLTRINFSSNKFNGSISP----LCGSSSYLSFDVTENGFEGDIPLELGKSTNLDRLRLGKNQFTGRIP---RTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHIDLNNNYLSGVIPTWLGKLPLLGELKLSSNKFVGSLP 689

HSP 4
Score: 78.5666 bits (192), Expect = 2.44249e-14
Identity = 54/159 (33.96%), Postives = 81/159 (50.94%), Query Frame = 2
Query:   23 NGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGI-SLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
N G +P L N +L+ L++ NSFSG+IP + S+++++ GN LQG IP+ +T +G + + + +L L L+ N LSG +PK I S +LK+L L + SG +P + C L LDLS+N TG IPD
Sbjct: 226 NRLNGSLPAEL-NRLKNLQTLNLGDNSFSGEIPSQLGDLV-SIQYLNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVIHE---EFWRMNQLEFLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIPAEISNCQSLKLLDLSNNTLTGQIPD 379

HSP 5
Score: 78.5666 bits (192), Expect = 2.44249e-14
Identity = 57/164 (34.76%), Postives = 75/164 (45.73%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++L L +N FTG IP + + L LD+S NS SG IP C L + N L G IP + +F G P SLT + L L N+L+G IP+ I + L L L+ N+ SG LP +G L +L LS N TG IP
Sbjct: 603 DRLRLGKNQFTGRIPRTFGKIS-ELSLLDISRNSLSGIIPVEL-GLCKKLTHIDLNNNYLSGVIPTWLGKLPLLGELKLSSNKFVGSLP---TEIFSLTNILTLFLDGNSLNGSIPQEIGNLQALNALNLEENQLSGPLPSTIGKLSKLFELRLSRNALTGEIP 761

HSP 6
Score: 75.485 bits (184), Expect = 2.06769e-13
Identity = 57/163 (34.97%), Postives = 78/163 (47.85%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKE-LKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++L+ N +G IPT L L L +SSN F G +P F S ++ + GNSL GSIP+ I + SG P L++L L LS NAL+G IP I + +L+ L L N F+G +P + P L LDLS N G +P
Sbjct: 653 IDLNNNYLSGVIPTWLGKLPL-LGELKLSSNKFVGSLPTEIF-SLTNILTLFLDGNSLNGSIPQEIGNLQALNALNLEENQLSGPLPSTIG---KLSKLFELRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLPKLESLDLSHNQLVGEVP 810

HSP 7
Score: 75.0998 bits (183), Expect = 2.70049e-13
Identity = 53/162 (32.72%), Postives = 76/162 (46.91%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++LS N G IPT+L N + SL+ L + SN SG IP S +L+ + N L G+IP + R +G P + + L +L+ L L N L G IP I +L NR +G+LP + +L L+L DN F+G IP
Sbjct: 100 IDLSSNRLVGPIPTTLSNLSSSLESLHLFSNLLSGDIPSQL-GSLVNLKSLKLGDNELNGTIPETFGNLVNLQMLALASCRLTGLIP---SRFGRLVQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAELNRLKNLQTLNLGDNSFSGEIP 257

HSP 8
Score: 64.6994 bits (156), Expect = 3.64982e-10
Identity = 45/163 (27.61%), Postives = 72/163 (44.17%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSI 490
++ L N G++P + L+ + + N FSG++P +C L+ + + GN L G IP SI G+ P +T V+DL+ N LSG IP + L+ + N GNLP + +L++++ S N F GSI
Sbjct: 412 QEFTLYHNNLEGKVPKEI-GFLGKLEIMYLYENRFSGEMPVEI-GNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGNCHQMT---VIDLADNQLSGSIPSSFGFLTALELFMIYNNSLQGNLPDSLINLKNLTRINFSSNKFNGSI 569

HSP 9
Score: 62.003 bits (149), Expect = 2.36575e-09
Identity = 55/211 (26.07%), Postives = 82/211 (38.86%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGF-----------------------FESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E L+L N +G+IP+ L + +LK L + N +G IP+ F F L+ + N L+G IP I R +G P N L L+ L+L N+ SG IP + + +++ L L GN+ G +P + +L LDLS N TG I + +G LP
Sbjct: 123 ESLHLFSNLLSGDIPSQL-GSLVNLKSLKLGDNELNGTIPETFGNLVNLQMLALASCRLTGLIPSRFGRLVQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAELN---RLKNLQTLNLGDNSFSGEIPSQLGDLVSIQYLNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVIHEEFWRMNQLEFLVLAKNRLSGSLP 329

IMK2_ARATH2.13e-1836.42%
Probably inactive leucine-rich repeat re...
HSP 1
Score: 92.0485 bits (227), Expect = 2.13477e-18
Identity = 59/162 (36.42%), Postives = 80/162 (49.38%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+L N +G IP N + LK L++ N FSG +P + L VS + N L GSIPR +G PD + +L+ L L+L N L G IP I +HNL EL L+ N+ +G +P +G + KLDLS+N FTG IP
Sbjct: 219 LDLQHNNLSGSIPDFFVNGSHPLKTLNLDHNRFSGAVPVSLCKH-SLLEEVSISHNQLSGSIPRECGGLPHLQSLDFSYNSINGTIPD---SFSNLSSLVSLNLESNHLKGPIPDAIDRLHNLTELNLKRNKINGPIPETIGNISGIKKLDLSENNFTGPIP 376

HSP 2
Score: 87.0409 bits (214), Expect = 6.86732e-17
Identity = 59/162 (36.42%), Postives = 79/162 (48.77%), Query Frame = 2
Query:   14 LSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDF-ANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L N +G IP SL N L+ LD+SSN +G IP ES R ++ + NSL G +P S+ SG PDF NG L + L+L HN SG +P + L+E+ + N+ SG++P G PHL LD S N G+IPD
Sbjct: 149 LFNNRLSGSIPVSLGNCPL-LQNLDLSSNQLTGAIPPSLTESTRLYR-LNLSFNSLSGPLPVSVARSYTLTFLDLQHNNLSGSIPDFFVNGSHPL---KTLNLDHNRFSGAVPVSLCKHSLLEEVSISHNQLSGSIPRECGGLPHLQSLDFSYNSINGTIPD 305

HSP 3
Score: 75.8702 bits (185), Expect = 1.58318e-13
Identity = 52/165 (31.52%), Postives = 80/165 (48.48%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSL---RFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
LNL N F+G +P SL + L+ + +S N SG IP CG L + + F+ NS+ G+IP S + G PD + +LT L +L N ++G IP+ I I +K+L L N F+G +P+ + LS ++S N +G +P
Sbjct: 244 LNLDHNRFSGAVPVSLCKHSL-LEEVSISHNQLSGSIP----RECGGLPHLQSLDFSYNSINGTIPDSFSNLSSLVSLNLESNHLKGPIPDAIDRLHNLTEL---NLKRNKINGPIPETIGNISGIKKLDLSENNFTGPIPLSLVHLAKLSSFNVSYNTLSGPVP 400

HSP 4
Score: 63.929 bits (154), Expect = 6.22566e-10
Identity = 47/121 (38.84%), Postives = 58/121 (47.93%), Query Frame = 2
Query:  143 GSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTR---LRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
GSLR +S N + GS+PRS+ R SG P VSL L+ LDLS N L+G IP ++ L L L N SG LPV + L+ LDL N +GSIPD
Sbjct: 118 GSLRKLSLHNNVIAGSVPRSLGYLKSLRGVYLFNNRLSGSIP------VSLGNCPLLQNLDLSSNQLTGAIPPSLTESTRLYRLNLSFNSLSGPLPVSVARSYTLTFLDLQHNNLSGSIPD 232

HSP 5
Score: 62.3882 bits (150), Expect = 1.81139e-09
Identity = 29/67 (43.28%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  293 LTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L LR L L +N ++G +P+ + + +L+ + L NR SG++PV +G CP L LDLS N TG+IP
Sbjct: 117 LGSLRKLSLHNNVIAGSVPRSLGYLKSLRGVYLFNNRLSGSIPVSLGNCPLLQNLDLSSNQLTGAIP 183

RCH2_ARATH2.79e-1834.36%
Receptor-like protein kinase 2 OS=Arabid...
HSP 1
Score: 91.6633 bits (226), Expect = 2.7881e-18
Identity = 56/163 (34.36%), Postives = 82/163 (50.31%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+L L N TGEIP+ + + + FLD SSN G++PD SC L+ + + NSL+GS+P ++ SL+ L+VLD+S N SG IP + + +L +L L N FSG++P +G+C L LDL N +G IP
Sbjct: 470 RLRLGFNRITGEIPSGIGSLK-KINFLDFSSNRLHGKVPDEI-GSCSELQMIDLSNNSLEGSLPNPVS---------------------------SLSGLQVLDVSANQFSGKIPASLGRLVSLNKLILSKNLFSGSIPTSLGMCSGLQLLDLGSNELSGEIP 603

HSP 2
Score: 90.8929 bits (224), Expect = 4.75577e-18
Identity = 61/164 (37.20%), Postives = 84/164 (51.22%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+ L+LSRN TG IP+ L K L +S NS SG IP +C SL + N + G IP I R G PD S + L+++DLS+N+L G +P +S + L+ L + N+FSG +P +G L+KL LS NLF+GSIP
Sbjct: 421 QALDLSRNSLTGTIPSGLFMLRNLTKLLLIS-NSLSGFIPQEI-GNCSSLVRLRLGFNRITGEIPSGIGSLKKINFLDFSSNRLHGKVPDEIG---SCSELQMIDLSNNSLEGSLPNPVSSLSGLQVLDVSANQFSGKIPASLGRLVSLNKLILSKNLFSGSIP 579

HSP 3
Score: 84.3445 bits (207), Expect = 4.45127e-16
Identity = 55/162 (33.95%), Postives = 79/162 (48.77%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++LS N +G IP+S+ + +F+ +S N FSG IP +C SL + N + G IP + + G P G T L+ LDLS N+L+G IP G+ ++ NL +L L N SG +P +G C L +L L N TG IP
Sbjct: 327 IDLSLNLLSGSIPSSIGRLSFLEEFM-ISDNKFSGSIPTTI-SNCSSLVQLQLDKNQISGLIPSELGTLTKLTLFFAWSNQLEGSIPP---GLADCTDLQALDLSRNSLTGTIPSGLFMLRNLTKLLLISNSLSGFIPQEIGNCSSLVRLRLGFNRITGEIP 483

HSP 4
Score: 80.8777 bits (198), Expect = 4.92145e-15
Identity = 56/187 (29.95%), Postives = 78/187 (41.71%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+L L +N +G IP+ L T L SN G IP G + C L+ + + NSL G+IP + SG P SL RLR L N ++G IP GI + + L NR G +P +G C L +DLS+N GS+P+ F+G +P
Sbjct: 374 QLQLDKNQISGLIPSELGTLT-KLTLFFAWSNQLEGSIPPGLAD-CTDLQALDLSRNSLTGTIPSGLFMLRNLTKLLLISNSLSGFIPQEIGNCSSLVRLR---LGFNRITGEIPSGIGSLKKINFLDFSSNRLHGKVPDEIGSCSELQMIDLSNNSLEGSLPNPVSSLSGLQVLDVSANQFSGKIP 555

HSP 5
Score: 78.9518 bits (193), Expect = 1.87015e-14
Identity = 55/165 (33.33%), Postives = 79/165 (47.88%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
E+ +S N F+G IPT++ N + SL L + N SG IP F +++ N L+GSIP + +G P +G L L L L N+LSGFIP+ I +L L+L NR +G +P G+G ++ LD S N G +PD
Sbjct: 349 EEFMISDNKFSGSIPTTISNCS-SLVQLQLDKNQISGLIPSELGTLTKLTLFFAWS-NQLEGSIPPGLADCTDLQALDLSRNSLTGTIP---SGLFMLRNLTKLLLISNSLSGFIPQEIGNCSSLVRLRLGFNRITGEIPSGIGSLKKINFLDFSSNRLHGKVPD 508

HSP 6
Score: 75.485 bits (184), Expect = 2.06769e-13
Identity = 51/162 (31.48%), Postives = 76/162 (46.91%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L L+ +G +P+SL L+ L + + SG+IP +C L + NSL GSIPR I G P+ + + L+++DLS N LSG IP I + L+E + N+FSG++P + C L +L L N +G IP
Sbjct: 231 LGLAETSVSGNLPSSLGKLK-KLETLSIYTTMISGEIPSDL-GNCSELVDLFLYENSLSGSIPREIGQLTKLEQLFLWQNSLVGGIPEEIG---NCSNLKMIDLSLNLLSGSIPSSIGRLSFLEEFMISDNKFSGSIPTTISNCSSLVQLQLDKNQISGLIP 387

HSP 7
Score: 70.4774 bits (171), Expect = 6.65154e-12
Identity = 51/163 (31.29%), Postives = 76/163 (46.63%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXR-FSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS NG G+IP SL +L+ L ++SN +G+IP C L+ + N L GSIP + + SG P +LT VL L+ ++SG +P + + L+ L + SG +P +G C L L L +N +GSIP
Sbjct: 134 LDLSSNGLVGDIPWSLSKLR-NLETLILNSNQLTGKIPPDI-SKCSKLKSLILFDNLLTGSIPTELGKLSGLEVIRIGGNKEISGQIPSEIGDCSNLT---VLGLAETSVSGNLPSSLGKLKKLETLSIYTTMISGEIPSDLGNCSELVDLFLYENSLSGSIP 291

HSP 8
Score: 68.9366 bits (167), Expect = 1.9353e-11
Identity = 56/156 (35.90%), Postives = 72/156 (46.15%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSI-TXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDN 472
L++S N F+G+IP SL SL L +S N FSG IP C L+ + N L G IP + R +G P + SL +L +LDLSHN L G + ++ I NL L + N FSG LP L LS DL N
Sbjct: 543 LDVSANQFSGKIPASLGRLV-SLNKLILSKNLFSGSIPTSL-GMCSGLQLLDLGSNELSGEIPSELGDIENLEIALNLSSNRLTGKIP---SKIASLNKLSILDLSHNMLEGDLAP-LANIENLVSLNISYNSFSGYLPDNK-LFRQLSPQDLEGN 691

HSP 9
Score: 62.7734 bits (151), Expect = 1.38693e-09
Identity = 41/124 (33.06%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  131 FESCGSLRFVS---FAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
F +C S F++ LQ S+P+++ +G P+ + L +VLDLS N L G IP +S + NL+ L L N+ +G +P + C L L L DNL TGSIP
Sbjct: 74 FITCSSQGFITDIDIESVPLQLSLPKNLPAFRSLQKLTISGANLTGTLPESLGDCLGL---KVLDLSSNGLVGDIPWSLSKLRNLETLILNSNQLTGKIPPDISKCSKLKSLILFDNLLTGSIP 194

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CF810502
Best 10 Hits Shown

Match Name E value Identity Description
B9RWV4_RICCO3.60e-4450.53%
Receptor protein kinase, putative OS=Ric...
HSP 1
Score: 181.415 bits (459), Expect = 3.603e-44
Identity = 95/188 (50.53%), Postives = 121/188 (64.36%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E LNLS N +G IP+S N T +++FLD+S NS SG +PD F++C SLR++S AGNSLQG +P ++ FSG+ PDF +G SL RLR LDLS+N SG +P G+S +HNLK+L+LQGNRFSG LPV GLC HL +LDLS+NLFTG++PD MFT D P
Sbjct: 125 ESLNLSHNSLSGLIPSSFVNMT-TVRFLDLSENSLSGPLPDNLFQNCLSLRYISLAGNSLQGPLPSTLARCSSLNTLNLSSNHFSGN-PDFFSGIWSLKRLRTLDLSNNEFSGSLPIGVSSLHNLKDLQLQGNRFSGTLPVDTGLCTHLLRLDLSNNLFTGALPDSLKWLGSLTFISLSNNMFTDDFP 310

HSP 2
Score: 81.2629 bits (199), Expect = 5.07442e-14
Identity = 51/164 (31.10%), Postives = 88/164 (53.66%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPD--GFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LSRN TG I + + +L++L++S N+ ++P G+F++ L + +++ GSIP I G P+ + + + +L LSHN LSG IPK I+ ++NLK LKL+ N+ SG +P+ +G +L +++S N+ G +P
Sbjct: 418 LDLSRNNLTGNIRAEM-GLSSNLRYLNLSWNNLQSRMPQELGYFQN---LTVLDLRNSAISGSIPADICESGSLSILQLDGNSIVGSIPEEIG---NCSTMYLLSLSHNNLSGPIPKSIAKLNNLKILKLEFNKLSGEIPLELGKLENLLAVNISYNMLIGRLP 574

HSP 3
Score: 77.411 bits (189), Expect = 7.32745e-13
Identity = 56/162 (34.57%), Postives = 78/162 (48.15%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+NLS N FTG+IPTS+ + L + + NSF G IP+G F L V F+ N L GSIP + +F G L++LDLS N L+G I + L NL+ L L N +P +G +L+ LDL ++ +GSIP
Sbjct: 346 INLSNNKFTGQIPTSMVQFS-KLSVIRLRGNSFIGTIPEGLFNL--GLEEVDFSDNKLIGSIPAGSS-------------KFYGS-------------LQILDLSRNNLTGNIRAEMGLSSNLRYLNLSWNNLQSRMPQELGYFQNLTVLDLRNSAISGSIP 478

HSP 4
Score: 75.8702 bits (185), Expect = 2.13196e-12
Identity = 50/163 (30.67%), Postives = 79/163 (48.47%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L+LS N F+G +P + ++ +LK L + N FSG +P C L + + N G++P S+ F+ DFP + ++ L LD S N L+G +P IS + +L + L N+F+G +P M LS + L N F G+IP+
Sbjct: 226 LDLSNNEFSGSLPIGV-SSLHNLKDLQLQGNRFSGTLPVDT-GLCTHLLRLDLSNNLFTGALPDSLKWLGSLTFISLSNNMFTDDFPQWIG---NIRNLEYLDFSSNLLTGSLPSSISDLKSLYFINLSNNKFTGQIPTSMVQFSKLSVIRLRGNSFIGTIPE 383

B9IA97_POPTR3.60e-4452.13%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 181.415 bits (459), Expect = 3.603e-44
Identity = 98/188 (52.13%), Postives = 120/188 (63.83%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E LNLS N +G IP+ L N + SLKFLD+S NSF+G +PD F + SLR++S AGN LQG IP S+ +FSGD PDF G SL RLR LDLSHN SG +P+G+S IHNLKEL LQGNRFSG LPV +GLC HL++LDLS NLF+G++P+ M TG+ P
Sbjct: 126 ESLNLSHNSLSGLIPSFLDNMS-SLKFLDLSENSFTGPLPDDLFRNSFSLRYLSLAGNLLQGPIPSSLFSCSSLNTINLSNNQFSGD-PDFVTGTWSLERLRKLDLSHNEFSGSVPQGVSAIHNLKELHLQGNRFSGPLPVDIGLCRHLNRLDLSSNLFSGALPESLQGLSSINYFSLSKNMLTGEFP 311

HSP 2
Score: 87.8113 bits (216), Expect = 5.42156e-16
Identity = 56/164 (34.15%), Postives = 82/164 (50.00%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
KL+LS N F+G +P + +A +LK L + N FSG +P C L + + N G++P S+ +G+FP + SL+ L LDLS NAL+G I I + +L+ L L N+ GN+P + C LS + L N F GSIP+
Sbjct: 226 KLDLSHNEFSGSVPQGV-SAIHNLKELHLQGNRFSGPLPVDI-GLCRHLNRLDLSSNLFSGALPESLQGLSSINYFSLSKNMLTGEFPRWIG---SLSNLEYLDLSSNALTGSISSSIGDLKSLRYLSLSNNKLLGNIPASIVSCTMLSAIRLRGNSFNGSIPE 384

HSP 3
Score: 78.5666 bits (192), Expect = 3.28915e-13
Identity = 57/162 (35.19%), Postives = 82/162 (50.62%), Query Frame = 2
Query:   11 NLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGIS-LIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+LS+N TGE P + + + +L++LD+SSN+ +G I + SLR++S + N L G+IP SI F+G P+ G L L +D SHN L G IP G S +L L L N +G++P MGL L L+LS N +P
Sbjct: 300 SLSKNMLTGEFPRWIGSLS-NLEYLDLSSNALTGSISSSIGD-LKSLRYLSLSNNKLLGNIPASIVSCTMLSAIRLRGNSFNGSIPE---GLFDLG-LEEVDFSHNGLIGSIPSGSSTFFTSLHTLDLSRNNLTGHIPAEMGLSSDLRYLNLSWNNLESRMP 455

HSP 4
Score: 77.411 bits (189), Expect = 7.32745e-13
Identity = 54/164 (32.93%), Postives = 81/164 (49.39%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPD--GFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LSRN TG IP + + L++L++S N+ ++P G+F++ L + N+L GSIP I G P+ SL +L LS N LSG IPK IS + LK LKL+ N +G +P +G +L +++S N G +P
Sbjct: 419 LDLSRNNLTGHIPAEM-GLSSDLRYLNLSWNNLESRMPPELGYFQN---LTVLDLRSNALAGSIPADICESGSLNILQLDGNSLVGQVPEEIGNCSSLY---LLSLSQNNLSGSIPKSISRLDKLKILKLEFNELTGEVPQELGKLENLLAVNISYNKLIGRLP 575

HSP 5
Score: 75.8702 bits (185), Expect = 2.13196e-12
Identity = 66/208 (31.73%), Postives = 87/208 (41.83%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPR-SITXXXXXXXXXXXXXRFSGDFPDFAN-----GYVSLT----------------RLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+LS N G IP S+ + T L + + NSF+G IP+G F+ L V F+ N L GSIP S T +G P Y++L+ L VLDL NAL+G IP I +L L+L GN G +P +G C L L LS N +GSIP TG++P
Sbjct: 347 LSLSNNKLLGNIPASIVSCTM-LSAIRLRGNSFNGSIPEGLFDL--GLEEVDFSHNGLIGSIPSGSSTFFTSLHTLDLSRNNLTGHIPAEMGLSSDLRYLNLSWNNLESRMPPELGYFQNLTVLDLRSNALAGSIPADICESGSLNILQLDGNSLVGQVPEEIGNCSSLYLLSLSQNNLSGSIPKSISRLDKLKILKLEFNELTGEVP 551

HSP 6
Score: 72.7886 bits (177), Expect = 1.80481e-11
Identity = 54/165 (32.73%), Postives = 80/165 (48.48%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCS-LKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++L+L N F+G +P + C L LD+SSN FSG +P+ + S+ + S + N L G PR I +G ++ L LR L LS+N L G IP I L ++L+GN F+G++P G+ L ++D S N GSIP
Sbjct: 249 KELHLQGNRFSGPLPVDI--GLCRHLNRLDLSSNLFSGALPESL-QGLSSINYFSLSKNMLTGEFPRWIGSLSNLEYLDLSSNALTGSI---SSSIGDLKSLRYLSLSNNKLLGNIPASIVSCTMLSAIRLRGNSFNGSIPEGL-FDLGLEEVDFSHNGLIGSIP 406

B9GUA2_POPTR1.05e-4351.06%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 179.874 bits (455), Expect = 1.04831e-43
Identity = 96/188 (51.06%), Postives = 121/188 (64.36%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E+LNLS N +G IP+ L N + S+KFLD+S NSFSG +PD F + SLR++S AGN LQG IP S+ FSGD PDF++G SL RLR LDLSHN SG +P+G+S IH LKEL+LQGNRFSG LP +GLCPHL++LDLS NLF+G++P+ M G+ P
Sbjct: 105 ERLNLSHNSLSGLIPSFLDNMS-SIKFLDLSENSFSGPLPDNLFRNSQSLRYLSLAGNLLQGPIPSSLLSCSSLNTINLSNNHFSGD-PDFSSGIWSLKRLRKLDLSHNEFSGSVPQGVSAIHFLKELQLQGNRFSGPLPGDIGLCPHLNRLDLSRNLFSGALPESLQRLSSMSLFSLSKNMLAGEFP 290

HSP 2
Score: 91.2781 bits (225), Expect = 4.90359e-17
Identity = 59/164 (35.98%), Postives = 82/164 (50.00%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
KL+LS N F+G +P + +A LK L + N FSG +P G C L + + N G++P S+ +G+FP + SLT L LDLS NAL+G IP I + +L+ L L N+ G +P M C LS + L N F GSIP+
Sbjct: 205 KLDLSHNEFSGSVPQGV-SAIHFLKELQLQGNRFSGPLP-GDIGLCPHLNRLDLSRNLFSGALPESLQRLSSMSLFSLSKNMLAGEFPRWIG---SLTNLEYLDLSSNALTGSIPSSIGDLKSLRYLSLSNNKLFGIIPTSMVSCTMLSVIRLRGNSFNGSIPE 363

HSP 3
Score: 79.7221 bits (195), Expect = 1.47643e-13
Identity = 67/208 (32.21%), Postives = 90/208 (43.27%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPR-SITXXXXXXXXXXXXXRFSGDFPDFAN-----GYVSLT----------------RLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+LS N G IPTS+ + T L + + NSF+G IP+G F+ L V F+ N L GSIP SIT +G P Y++L+ L VLDL ++AL G IP I +L L+L GN G +P +G C L L LS N +GSIP+ TG++P
Sbjct: 326 LSLSNNKLFGIIPTSMVSCTM-LSVIRLRGNSFNGSIPEGLFDL--RLEEVDFSDNGLVGSIPSGSITFFSSLHTLDLSKNNLTGHIPAERGLSSNLRYLNLSWNNLESRMPLELGYFQNLTVLDLRNSALVGLIPADICESGSLNILQLDGNSLVGQIPEEIGNCSSLYLLSLSQNNLSGSIPESISRLNKLKILKLEFNELTGEIP 530

HSP 4
Score: 70.8626 bits (172), Expect = 6.85829e-11
Identity = 52/156 (33.33%), Postives = 73/156 (46.79%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNL 475
LNLS N +P L +L LD+ +++ G IP ES GSL + GNSL G IP I SG P+ + L +L++L L N L+G IP+ + + NL + + N+ G LPVG G+ P L + L NL
Sbjct: 422 LNLSWNNLESRMPLELGYFQ-NLTVLDLRNSALVGLIPADICES-GSLNILQLDGNSLVGQIPEEIGNCSSLYLLSLSQNNLSGSIPESIS---RLNKLKILKLEFNELTGEIPQELGKLENLLAVNVSYNKLVGRLPVG-GIFPSLDRSALQGNL 571

HSP 5
Score: 69.3218 bits (168), Expect = 1.99546e-10
Identity = 50/164 (30.49%), Postives = 81/164 (49.39%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPD--GFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS+N TG IP + +L++L++S N+ ++P G+F++ L + ++L G IP I G P+ SL +L LS N LSG IP+ IS ++ LK LKL+ N +G +P +G +L +++S N G +P
Sbjct: 398 LDLSKNNLTGHIPAER-GLSSNLRYLNLSWNNLESRMPLELGYFQN---LTVLDLRNSALVGLIPADICESGSLNILQLDGNSLVGQIPEEIGNCSSLY---LLSLSQNNLSGSIPESISRLNKLKILKLEFNELTGEIPQELGKLENLLAVNVSYNKLVGRLP 554

D7LPN8_ARALY1.91e-3745.21%
Putative uncharacterized protein OS=Arab...
HSP 1
Score: 159.073 bits (401), Expect = 1.91491e-37
Identity = 85/188 (45.21%), Postives = 118/188 (62.77%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+KL+LS N +G+IP+SL + + SL+ LD++ NSFSG + D FF +C SLR++S + N L+G IP ++ RFSG F +G+ L RLR LDLS N+LSG IP GI +HNLKEL+LQ N+FSG+LP +GLCPHL+++DLS NLF+G +P + +GD P
Sbjct: 127 QKLDLSHNNLSGQIPSSLGSIS-SLQHLDLTGNSFSGTLSDDFFNNCSSLRYLSLSHNHLEGQIPSTLFQCSVLNSLNLSRNRFSGSF---VSGFWRLERLRALDLSSNSLSGSIPLGILSLHNLKELQLQRNQFSGSLPSDIGLCPHLNRVDLSFNLFSGELPRTLQKLRSLNHFDLSKNLLSGDFP 310

HSP 2
Score: 85.1149 bits (209), Expect = 3.51415e-15
Identity = 62/184 (33.70%), Postives = 84/184 (45.65%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPR-SITXXXXXXXXXXXXXRFSGDFPDFANGYVS---------------------LTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L LS N +GEIP SL + L + + N FSG IPDG F+ L+ + F+GN GSIPR S +G P +++ L L VLDL ++AL G +P I +L+ L+L GN +G++P G+G C L L LS N TG IP
Sbjct: 346 LILSENKISGEIPESLESCQ-ELMIVQLKGNGFSGSIPDGLFDL--GLQEMDFSGNGFTGSIPRGSSRLFESLKRLDLSRNNLTGSIPGEVGLFINMRYLNLSWNHFNTRVPPEIEFLQNLIVLDLRYSALIGSVPADICESQSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIP 526

HSP 3
Score: 82.0333 bits (201), Expect = 2.97491e-14
Identity = 55/163 (33.74%), Postives = 78/163 (47.85%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L+LS N +G IP + + +LK L + N FSG +P C L V + N G +PR++ SGDFP + +T L LD S N L+G +P I + +LK+L L N+ SG +P + C L + L N F+GSIPD
Sbjct: 226 LDLSSNSLSGSIPLGILSLH-NLKELQLQRNQFSGSLPSDI-GLCPHLNRVDLSFNLFSGELPRTLQKLRSLNHFDLSKNLLSGDFPAWIG---DMTGLVHLDFSSNELTGELPSLIGNLRSLKDLILSENKISGEIPESLESCQELMIVQLKGNGFSGSIPD 383

HSP 4
Score: 79.337 bits (194), Expect = 1.92828e-13
Identity = 51/164 (31.10%), Postives = 87/164 (53.05%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++L+LSRN TG IP + ++++L++S N F+ ++P E +L + ++L GS+P I +G P+ G + + L++L LSHN L+G IPK +S + LK LKL+ N+ SG +P +G +L +++S N G +P
Sbjct: 416 KRLDLSRNNLTGSIPGEV-GLFINMRYLNLSWNHFNTRVPPEI-EFLQNLIVLDLRYSALIGSVPADICESQSLQILQLDGNSLTGSIPE---GIGNCSSLKLLSLSHNNLTGPIPKSLSNLQELKILKLEANKLSGEIPKELGELQNLLLVNVSFNRLIGRLP 574

HSP 5
Score: 65.4698 bits (158), Expect = 2.88143e-09
Identity = 47/156 (30.13%), Postives = 74/156 (47.44%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNL 475
L+L + G +P + + SL+ L + NS +G IP+G +C SL+ +S + N+L G IP+S++ +L L++L L N LSG IPK + + NL + + NR G LPVG G+ L + + NL
Sbjct: 466 LDLRYSALIGSVPADICESQ-SLQILQLDGNSLTGSIPEGI-GNCSSLKLLSLSHNNLTGPIPKSLS---------------------------NLQELKILKLEANKLSGEIPKELGELQNLLLVNVSFNRLIGRLPVG-GVFQSLDQSAIQGNL 591

Q8LQ10_ORYSJ2.51e-2938.17%
Putative receptor-like protein kinase OS...
HSP 1
Score: 132.109 bits (331), Expect = 2.50676e-29
Identity = 71/186 (38.17%), Postives = 103/186 (55.38%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
++LS N F+G +P +P SL++LD++ N+FSG +P F ++RF+ +GN G +P+ ++ + SG PDFA L+RLR LDLS N SG + GI+ +HNLK + L GNRF G +P +GLCPHLS +D+S N F G +PD F+GD+P
Sbjct: 123 IDLSYNAFSGPLPGDVP-LLASLRYLDLTGNAFSGPLPATF---PATVRFLMLSGNQFSGPLPQGLSKSSFLLHLNLSGNQLSGS-PDFAGALWPLSRLRALDLSRNQFSGTVTTGIANLHNLKTIDLSGNRFFGAVPSDIGLCPHLSTVDISSNAFDGQLPDSIAHLGSLVYFAASGNRFSGDVP 303

HSP 2
Score: 74.3294 bits (181), Expect = 6.20306e-12
Identity = 54/162 (33.33%), Postives = 81/162 (50.00%), Query Frame = 2
Query:   17 SRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPD--FANGYVSLTRLRVLDLSHNALSGFIPKG-ISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
S N F+G++P L + +L+ LD S N+ +G++PD + LR++S + N L G+IP +++ SG PD F G L LD+S NALSG +P G L L+ L L N+ +G +P M L +L L+LS N +P
Sbjct: 294 SGNRFSGDVPAWLGDLA-ALQHLDFSDNALTGRLPDSLGK-LKDLRYLSMSENQLSGAIPDAMSGCTKLAELHLRANNLSGSIPDALFDVG------LETLDMSSNALSGVLPSGSTKLAETLQWLDLSVNQITGGIPAEMALFMNLRYLNLSRNDLRTQLP 447

HSP 3
Score: 70.0922 bits (170), Expect = 1.16985e-10
Identity = 49/163 (30.06%), Postives = 74/163 (45.40%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+L+L N +G IP +L + L+ LD+SSN+ SG +P G + +L+++ + N + G IP + P L L VLDL + L G +P + +L L+L GN +G +P +G C L L L N TG IP
Sbjct: 362 ELHLRANNLSGSIPDALFDV--GLETLDMSSNALSGVLPSGSTKLAETLQWLDLSVNQITGGIPAEMALFMNLRYLNLSRNDLRTQLPPELG---LLRNLTVLDLRSSGLYGTMPSDLCEAGSLAVLQLDGNSLAGPIPDNIGNCSSLYLLSLGHNSLTGPIP 519

HSP 4
Score: 63.1586 bits (152), Expect = 1.43004e-08
Identity = 51/156 (32.69%), Postives = 70/156 (44.87%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNL 475
LNLSRN ++P L +L LD+ S+ G +P E+ GSL + GNSL G IP +I +G P G L +L +L L +N LSG IP+ + I +L + + NR G LP G+ L L NL
Sbjct: 435 LNLSRNDLRTQLPPEL-GLLRNLTVLDLRSSGLYGTMPSDLCEA-GSLAVLQLDGNSLAGPIPDNIGNCSSLYLLSLGHNSLTGPIPV---GMSELKKLEILRLEYNNLSGEIPQQLGGIESLLAVNVSHNRLVGRLPAS-GVFQSLDASALEGNL 584

Q0JFW9_ORYSJ2.51e-2938.17%
Os01g0957100 protein (Fragment) OS=Oryza...
HSP 1
Score: 132.109 bits (331), Expect = 2.50676e-29
Identity = 71/186 (38.17%), Postives = 103/186 (55.38%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
++LS N F+G +P +P SL++LD++ N+FSG +P F ++RF+ +GN G +P+ ++ + SG PDFA L+RLR LDLS N SG + GI+ +HNLK + L GNRF G +P +GLCPHLS +D+S N F G +PD F+GD+P
Sbjct: 33 IDLSYNAFSGPLPGDVP-LLASLRYLDLTGNAFSGPLPATF---PATVRFLMLSGNQFSGPLPQGLSKSSFLLHLNLSGNQLSGS-PDFAGALWPLSRLRALDLSRNQFSGTVTTGIANLHNLKTIDLSGNRFFGAVPSDIGLCPHLSTVDISSNAFDGQLPDSIAHLGSLVYFAASGNRFSGDVP 213

HSP 2
Score: 74.3294 bits (181), Expect = 6.20306e-12
Identity = 54/162 (33.33%), Postives = 81/162 (50.00%), Query Frame = 2
Query:   17 SRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPD--FANGYVSLTRLRVLDLSHNALSGFIPKG-ISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
S N F+G++P L + +L+ LD S N+ +G++PD + LR++S + N L G+IP +++ SG PD F G L LD+S NALSG +P G L L+ L L N+ +G +P M L +L L+LS N +P
Sbjct: 204 SGNRFSGDVPAWLGDLA-ALQHLDFSDNALTGRLPDSLGK-LKDLRYLSMSENQLSGAIPDAMSGCTKLAELHLRANNLSGSIPDALFDVG------LETLDMSSNALSGVLPSGSTKLAETLQWLDLSVNQITGGIPAEMALFMNLRYLNLSRNDLRTQLP 357

HSP 3
Score: 70.0922 bits (170), Expect = 1.16985e-10
Identity = 49/163 (30.06%), Postives = 74/163 (45.40%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+L+L N +G IP +L + L+ LD+SSN+ SG +P G + +L+++ + N + G IP + P L L VLDL + L G +P + +L L+L GN +G +P +G C L L L N TG IP
Sbjct: 272 ELHLRANNLSGSIPDALFDV--GLETLDMSSNALSGVLPSGSTKLAETLQWLDLSVNQITGGIPAEMALFMNLRYLNLSRNDLRTQLPPELG---LLRNLTVLDLRSSGLYGTMPSDLCEAGSLAVLQLDGNSLAGPIPDNIGNCSSLYLLSLGHNSLTGPIP 429

HSP 4
Score: 63.1586 bits (152), Expect = 1.43004e-08
Identity = 51/156 (32.69%), Postives = 70/156 (44.87%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNL 475
LNLSRN ++P L +L LD+ S+ G +P E+ GSL + GNSL G IP +I +G P G L +L +L L +N LSG IP+ + I +L + + NR G LP G+ L L NL
Sbjct: 345 LNLSRNDLRTQLPPEL-GLLRNLTVLDLRSSGLYGTMPSDLCEA-GSLAVLQLDGNSLAGPIPDNIGNCSSLYLLSLGHNSLTGPIPV---GMSELKKLEILRLEYNNLSGEIPQQLGGIESLLAVNVSHNRLVGRLPAS-GVFQSLDASALEGNL 494

A2WZ93_ORYSI4.28e-2938.17%
Putative uncharacterized protein OS=Oryz...
HSP 1
Score: 131.339 bits (329), Expect = 4.27588e-29
Identity = 71/186 (38.17%), Postives = 103/186 (55.38%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
++LS N F+G +P +P SL++LD++ N+FSG +P F ++RF+ +GN G +P+ ++ + SG PDFA L+RLR LDLS N SG + GI+ +HNLK + L GNRF G +P +GLCPHLS +D+S N F G +PD F+GD+P
Sbjct: 123 IDLSYNAFSGPLPGDVP-LLASLRYLDLTGNAFSGPLPATF---PATVRFLMLSGNQFSGPLPQGLSKSSFLLHLNLSGNQLSGS-PDFAGELWPLSRLRALDLSRNQFSGTVTTGIANLHNLKTIDLSGNRFFGAVPSDIGLCPHLSTVDISSNAFDGQLPDSIAHLGSLVYFAASGNRFSGDVP 303

HSP 2
Score: 74.3294 bits (181), Expect = 6.20306e-12
Identity = 54/162 (33.33%), Postives = 81/162 (50.00%), Query Frame = 2
Query:   17 SRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPD--FANGYVSLTRLRVLDLSHNALSGFIPKG-ISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
S N F+G++P L + +L+ LD S N+ +G++PD + LR++S + N L G+IP +++ SG PD F G L LD+S NALSG +P G L L+ L L N+ +G +P M L +L L+LS N +P
Sbjct: 294 SGNRFSGDVPAWLGDLA-ALQHLDFSDNALTGRLPDSLGK-LKDLRYLSMSENQLSGAIPDAMSGCTKLAELHLRANNLSGSIPDALFDVG------LETLDMSSNALSGVLPSGSTKLAETLQWLDLSVNQITGGIPAEMALFMNLRYLNLSRNDLRTQLP 447

HSP 3
Score: 70.0922 bits (170), Expect = 1.16985e-10
Identity = 49/163 (30.06%), Postives = 74/163 (45.40%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+L+L N +G IP +L + L+ LD+SSN+ SG +P G + +L+++ + N + G IP + P L L VLDL + L G +P + +L L+L GN +G +P +G C L L L N TG IP
Sbjct: 362 ELHLRANNLSGSIPDALFDV--GLETLDMSSNALSGVLPSGSTKLAETLQWLDLSVNQITGGIPAEMALFMNLRYLNLSRNDLRTQLPPELG---LLRNLTVLDLRSSGLYGTMPSDLCEAGSLAVLQLDGNSLAGPIPDNIGNCSSLYLLSLGHNSLTGPIP 519

HSP 4
Score: 63.1586 bits (152), Expect = 1.43004e-08
Identity = 51/156 (32.69%), Postives = 70/156 (44.87%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNL 475
LNLSRN ++P L +L LD+ S+ G +P E+ GSL + GNSL G IP +I +G P G L +L +L L +N LSG IP+ + I +L + + NR G LP G+ L L NL
Sbjct: 435 LNLSRNDLRTQLPPEL-GLLRNLTVLDLRSSGLYGTMPSDLCEA-GSLAVLQLDGNSLAGPIPDNIGNCSSLYLLSLGHNSLTGPIPV---GMSELKKLEILRLEYNNLSGEIPQQLGGIESLLAVNVSHNRLVGRLPAS-GVFQSLDASALEGNL 584

C5XIJ5_SORBI7.29e-2938.71%
Putative uncharacterized protein Sb03g04...
HSP 1
Score: 130.568 bits (327), Expect = 7.29354e-29
Identity = 72/186 (38.71%), Postives = 96/186 (51.61%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+LS N F+G +P + SL++LD++ N+FSG +P F + LRF+ +GN G +P + PDFA L RLR LDLS N SG + GI+ +HNLK L L GNRFSG +P +GLCPHLS +DLS N F G +PD +GD+P
Sbjct: 132 LDLSYNAFSGPLPDDVARLA-SLRYLDLTGNAFSGPLPPAFPRT---LRFLVLSGNQFSGPVPEGLAAKSPLLLHLNVSGNQLSGSPDFAGALWPLERLRTLDLSRNQFSGPVTDGIARLHNLKTLSLSGNRFSGAVPADIGLCPHLSTIDLSSNAFDGHLPDSIGQLGSLVYLSASGNRLSGDVP 313

HSP 2
Score: 84.3445 bits (207), Expect = 5.99423e-15
Identity = 57/163 (34.97%), Postives = 82/163 (50.31%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCS-LKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N F+G +P + C L +D+SSN+F G +PD + GSL ++S +GN L G +P + F+G PD L L+ L LS N LSG +P +S L EL L+GN SG++P + L LD+S N +G +P
Sbjct: 253 LSLSGNRFSGAVPADI--GLCPHLSTIDLSSNAFDGHLPDSIGQ-LGSLVYLSASGNRLSGDVPAWLGKLAAVQHLDLSDNAFTGSLPDSLG---DLKALKYLSLSRNQLSGAVPASMSGCTKLAELHLRGNSLSGSIPDAL-FDVGLETLDVSSNALSGVLP 408

HSP 3
Score: 73.559 bits (179), Expect = 1.05808e-11
Identity = 53/163 (32.52%), Postives = 74/163 (45.40%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+L+L N +G IP +L + L+ LDVSSN+ SG +P G +L+++ +GN L G IP ++ P L L VLDL L G +P + +L L+L GN SG +P +G C L L L N TG IP
Sbjct: 372 ELHLRGNSLSGSIPDALFDV--GLETLDVSSNALSGVLPSGSTRLAETLQWLDLSGNMLTGGIPTEMSLFFKLRYLNLSRNDLRTPLPPELG---LLRNLTVLDLRSTGLYGAMPADLCESGSLAVLQLDGNSLSGPIPDSIGNCSSLYLLSLGHNGLTGPIP 529

HSP 4
Score: 69.707 bits (169), Expect = 1.52787e-10
Identity = 53/162 (32.72%), Postives = 73/162 (45.06%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
LNLSRN +P L +L LD+ S G +P ES GSL + GNSL G IP SI + + L +L L HN L+G IP GIS + L+ L+L+ N SG +P +G +L +++S N G +P
Sbjct: 445 LNLSRNDLRTPLPPEL-GLLRNLTVLDLRSTGLYGAMPADLCES-GSLAVLQLDGNSLSGPIPDSIG---------------------------NCSSLYLLSLGHNGLTGPIPAGISELKKLEILRLEYNNLSGEIPAQLGGLENLLAVNISHNRLVGRLP 577

HSP 5
Score: 68.1662 bits (165), Expect = 4.44541e-10
Identity = 45/140 (32.14%), Postives = 65/140 (46.43%), Query Frame = 2
Query:   74 LKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+ LD+S N FSG + DG +L+ +S +GN G++P I F G PD SL L S N LSG +P + + ++ L L N F+G+LP +G L L LS N +G++P
Sbjct: 226 LRTLDLSRNQFSGPVTDGIAR-LHNLKTLSLSGNRFSGAVPADIGLCPHLSTIDLSSNAFDGHLPDSIGQLGSLV---YLSASGNRLSGDVPAWLGKLAAVQHLDLSDNAFTGSLPDSLGDLKALKYLSLSRNQLSGAVP 361

HSP 6
Score: 60.4622 bits (145), Expect = 9.26925e-08
Identity = 49/146 (33.56%), Postives = 70/146 (47.95%), Query Frame = 2
Query:   62 ATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGL-CPHLSKLDLSDNLFTGSIPD 496
AT + L + + SG +P G + +L+ +S A N+L G +P ++ FSG PD L LR LDL+ NA SG +P L+ L L GN+FSG +P G+ P L L++S N +GS PD
Sbjct: 77 ATSRVLRLALDGLALSGSMPRGL-DRLPALQDLSLARNNLSGPLPPGLSLLGSLRSLDLSYNAFSGPLPD---DVARLASLRYLDLTGNAFSGPLPPAFP--RTLRFLVLSGNQFSGPVPEGLAAKSPLLLHLNVSGNQLSGS-PD 215

B9IQ62_POPTR9.53e-2939.57%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 130.183 bits (326), Expect = 9.52566e-29
Identity = 74/187 (39.57%), Postives = 101/187 (54.01%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
KL+LSRN TG I +L SL+ +D+S NS SG I + FF+ C +LR +S A N G IP S++ +F+G P G L LR LDLS N L G IPKGI +++NL+ + L NRF+G +P G+G C L +D S+N+ +G IPD MFTG++P
Sbjct: 100 KLSLSRNNLTGSINPNLTRLE-SLRIIDLSENSLSGTISEDFFKECAALRDLSLANNKFSGKIPGSLSSCASLASINLSSNQFTGSLPA---GIWGLNGLRSLDLSGNLLDGEIPKGIEVLNNLRSINLSKNRFNGGVPDGIGSCLLLRSVDFSENMLSGHIPDTMQKLGLCDYLSLSSNMFTGEVP 282

HSP 2
Score: 97.4413 bits (241), Expect = 6.8424e-19
Identity = 62/162 (38.27%), Postives = 83/162 (51.23%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N GEIP + +L+ +++S N F+G +PDG SC LR V F+ N L G IP ++ F+G+ P++ L RL LDLS N SG +P I + LK L L N SGNLP M C +L LD S NL +G +P
Sbjct: 198 LDLSGNLLDGEIPKGI-EVLNNLRSINLSKNRFNGGVPDGI-GSCLLLRSVDFSENMLSGHIPDTMQKLGLCDYLSLSSNMFTGEVPNWIG---ELNRLETLDLSGNRFSGQVPISIGKLQLLKVLNLSANGLSGNLPESMANCGNLLALDFSQNLLSGDLP 354

HSP 3
Score: 94.3597 bits (233), Expect = 5.79244e-18
Identity = 68/210 (32.38%), Postives = 98/210 (46.67%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIP------------------------KGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+L+ N F+G+IP SL ++ SL +++SSN F+G +P G + G LR + +GN L G IP+ I RF+G PD G S LR +D S N LSG IP I ++ L+ L L GNRFSG +P+ +G L L+LS N +G++P+ + +GDLP
Sbjct: 150 LSLANNKFSGKIPGSL-SSCASLASINLSSNQFTGSLPAGIWGLNG-LRSLDLSGNLLDGEIPKGIEVLNNLRSINLSKNRFNGGVPD---GIGSCLLLRSVDFSENMLSGHIPDTMQKLGLCDYLSLSSNMFTGEVPNWIGELNRLETLDLSGNRFSGQVPISIGKLQLLKVLNLSANGLSGNLPESMANCGNLLALDFSQNLLSGDLP 354

HSP 4
Score: 85.5001 bits (210), Expect = 2.69069e-15
Identity = 60/164 (36.59%), Postives = 82/164 (50.00%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E L+LS N F+G++P S+ LK L++S+N SG +P+ +CG+L + F+ N L G +P I + SG F S RL+ LDLSHN SG I I ++ +L+ L L N G +P G L LDLSDN GSIP
Sbjct: 292 ETLDLSGNRFSGQVPISIGKLQL-LKVLNLSANGLSGNLPES-MANCGNLLALDFSQNLLSGDLPTWI-FGSRSEKVLHLENKLSGKFS-------SAPRLQFLDLSHNDFSGKIASSIGVLSSLQFLNLSKNSLFGPVPGTFGDLKELDILDLSDNKLNGSIP 445

HSP 5
Score: 82.8037 bits (203), Expect = 1.74406e-14
Identity = 65/204 (31.86%), Postives = 81/204 (39.71%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIP------------------DGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
LNLS NG +G +P S+ N +L LD S N SG +P G F S L+F+ + N G I SI G P + L L +LDLS N L+G IP I LKEL+L+ N SG +P +G C L L LS N G+IP TG LP
Sbjct: 318 LNLSANGLSGNLPESMANCG-NLLALDFSQNLLSGDLPTWIFGSRSEKVLHLENKLSGKFSSAPRLQFLDLSHNDFSGKIASSIGVLSSLQFLNLSKNSLFGPVP---GTFGDLKELDILDLSDNKLNGSIPTEIGGAFALKELRLERNSLSGQIPDSIGNCSSLMTLILSQNNLAGTIPAAIAKLGNLKDVDLSLNSLTGSLP 517

HSP 6
Score: 82.4185 bits (202), Expect = 2.27781e-14
Identity = 56/162 (34.57%), Postives = 79/162 (48.77%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N F+G+I +S+ SL+FL++S NS G +P G F L + + N L GSIP I SG PD SL L LS N L+G IP I+ + NLK++ L N +G+LP + P+L ++S N G +P
Sbjct: 385 LDLSHNDFSGKIASSI-GVLSSLQFLNLSKNSLFGPVP-GTFGDLKELDILDLSDNKLNGSIPTEIGGAFALKELRLERNSLSGQIPDSIGNCSSLM---TLILSQNNLAGTIPAAIAKLGNLKDVDLSLNSLTGSLPKQLANLPNLISFNISHNNLQGELP 541

HSP 7
Score: 58.151 bits (139), Expect = 4.60028e-07
Identity = 42/131 (32.06%), Postives = 61/131 (46.56%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGN 400
L+LS N G IPT + A +LK L + NS SGQIPD +C SL + + N+L G+IP +I +G P +L L ++SHN L G +P G+ + + + GN
Sbjct: 433 LDLSDNKLNGSIPTEIGGAF-ALKELRLERNSLSGQIPDSI-GNCSSLMTLILSQNNLAGTIPAAIAKLGNLKDVDLSLNSLTGSLP---KQLANLPNLISFNISHNNLQGELPAGV-FFNTISPSSVSGN 557

D7LVF2_ARALY1.62e-2845.12%
Putative uncharacterized protein OS=Arab...
HSP 1
Score: 129.413 bits (324), Expect = 1.62483e-28
Identity = 74/164 (45.12%), Postives = 93/164 (56.71%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
KL+LS N TG I +L + +LK +D+SSN SG +PDGFF CGSLR +S A N L G IP SI+ FSG P G SL LR LDLS N L G P+ I ++NL+ L L NR SG +P +G C L +DLS+N +GS+PD
Sbjct: 97 KLSLSNNNLTGIINPNLLLSLVNLKVVDLSSNGLSGSLPDGFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNSFSGSMP---LGIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRSLDLSRNRLSGTIPSEIGSCMLLKTIDLSENSLSGSVPD 257

HSP 2
Score: 93.5893 bits (231), Expect = 9.8804e-18
Identity = 59/176 (33.52%), Postives = 89/176 (50.57%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFA--------------NGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
LNL +NG GE+P + SL++LD+S N FSG +PD +L+ ++F+GN L GS+P S +G+ P + N + ++ VLDLSHN+ SG I G+ + +L+ L L N +G++P +G HL LDLS N +G+IP
Sbjct: 268 LNLGKNGLEGEVPKWIGEMR-SLEYLDLSMNKFSGHVPDSIGNLL-ALKVLNFSGNGLIGSLPDSTANCINLLALDFSGNSLTGNLPMWIFQDDSRDVSAFKSDNSTGGIKKILVLDLSHNSFSGEIGAGLGDLRDLEALHLSRNSLTGHIPSTIGELKHLGVLDLSHNELSGTIP 441

HSP 3
Score: 77.411 bits (189), Expect = 7.32745e-13
Identity = 69/226 (30.53%), Postives = 91/226 (40.27%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIP-----------------RSITXXXXXXXXXXXXXRFSG-------DFPDFANGYVS--------------LTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E L+LS N F+G +P S+ N +LK L+ S N G +PD +C +L + F+GNSL G++P S FSG D D ++S L L VLDLSHN LSG IP+ +L+ L+L+ N GN+P + C L L LS N GSIP TG LP
Sbjct: 290 EYLDLSMNKFSGHVPDSIGNLL-ALKVLNFSGNGLIGSLPDST-ANCINLLALDFSGNSLTGNLPMWIFQDDSRDVSAFKSDNSTGGIKKILVLDLSHNSFSGEIGAGLGDLRDLEALHLSRNSLTGHIPSTIGELKHLGVLDLSHNELSGTIPRETGGAVSLEGLRLENNLLEGNIPSSIKNCSSLRSLILSHNKLIGSIPPELAKLTKLEEVDLSFNELTGTLP 513

HSP 4
Score: 68.1662 bits (165), Expect = 4.44541e-10
Identity = 54/159 (33.96%), Postives = 75/159 (47.17%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCG--SLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDN 472
E L+LSRN TG IP+++ L LD+S N SG IP E+ G SL + N L+G+IP SI + G P LT+L +DLS N L+G +PK ++ + L+ + N G LP G G+ LS +S N
Sbjct: 403 EALHLSRNSLTGHIPSTIGELK-HLGVLDLSHNELSGTIPR---ETGGAVSLEGLRLENNLLEGNIPSSIKNCSSLRSLILSHNKLIGSIPP---ELAKLTKLEEVDLSFNELTGTLPKQLANLGYLQTFNISHNHLFGELPAG-GIFNGLSPSSVSGN 553

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CF810502
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010316580015.04e-2639.16%GSVIVT01031658001 assembled CDS
HSP 1
Score: 113.62 bits (283), Expect = 5.03773e-26
Identity = 65/166 (39.16%), Postives = 97/166 (58.43%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFS-GDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
E+LNLS N +G IP+SL N T S++FLD+S NS +G IPD FE+ SLR +S + N L+G IP ++ +FS GDFP + S++ + +D S N +G +P + + +L+ L L NR +G++P + CP LS + L N F+GSIP+
Sbjct: 105 ERLNLSHNSLSGRIPSSLSNMT-SIRFLDLSHNSLAGPIPDEMFENYSSLRSLSLSMNFLEGPIPSALLRCTTLSNLNLSSNQFSAGDFPQWIG---SMSSVEYVDFSGNGFTGSLPASMGNLKSLQFLSLSDNRLTGSIPGSLFYCPKLSVIRLRGNGFSGSIPE 266

HSP 2
Score: 82.4185 bits (202), Expect = 1.24372e-16
Identity = 59/188 (31.38%), Postives = 79/188 (42.02%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E ++ S NGFTG +P S+ N SL+FL +S N +G IP F C L + GN GSIP + G P ++ L LDLS N L+G IP I L +L+ L L N +P +G +L+ LDL + GSIP TG +P
Sbjct: 203 EYVDFSGNGFTGSLPASMGNLK-SLQFLSLSDNRLTGSIPGSLFY-CPKLSVIRLRGNGFSGSIPEGL-FDLGLDEVDLSGNELEGPIPPGSSRLFE--SLHSLDLSRNKLTGSIPAEIGLFSSLRYLNLSWNSLRSRMPPELGYFQNLTVLDLRNTFLFGSIPGDICDSGSLGILQLDGNSLTGPIP 385

HSP 3
Score: 75.0998 bits (183), Expect = 1.98563e-14
Identity = 51/164 (31.10%), Postives = 83/164 (50.61%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPD--GFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LSRN TG IP + SL++L++S NS ++P G+F++ L + L GSIP I +G PD + + + L +L +SHN L+G IPK +++ L+ L+L+ N SG +P +G +L +++S N G +P
Sbjct: 301 LDLSRNKLTGSIPAEI-GLFSSLRYLNLSWNSLRSRMPPELGYFQN---LTVLDLRNTFLFGSIPGDICDSGSLGILQLDGNSLTGPIPD---EFGNCSSLYLLSMSHNELNGSIPKSFAMLKKLEILRLEFNELSGEIPRELGSLENLLAVNVSYNRLIGRLP 457

HSP 4
Score: 66.6254 bits (161), Expect = 7.06225e-12
Identity = 55/181 (30.39%), Postives = 77/181 (42.54%), Query Frame = 2
Query:   26 GFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFS-GNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
G +G+I L +LK L +S N+FSG I G L ++ + NSL G IP S++ +G PD + + + LR L LS N L G IP + L L L N+FS G+ P +G + +D S N FTGS+P TG +P
Sbjct: 65 GLSGKIGRGLEKLQ-NLKVLSLSFNNFSGSISPELALITG-LERLNLSHNSLSGRIPSSLSNMTSIRFLDLSHNSLAGPIPD--EMFENYSSLRSLSLSMNFLEGPIPSALLRCTTLSNLNLSSNQFSAGDFPQWIGSMSSVEYVDFSGNGFTGSLPASMGNLKSLQFLSLSDNRLTGSIP 241

GSVIVT010254800012.42e-2037.65%GSVIVT01025480001 assembled CDS
HSP 1
Score: 94.7449 bits (234), Expect = 2.42164e-20
Identity = 61/162 (37.65%), Postives = 88/162 (54.32%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N +G+IP SL A +LK L++S N SG+IP F + ++ + + N L GSIP+++T + +G PD G+ +L+ L LDLS N SG IP + + L++L L GN SG +P +G L L LS N F+GSIP
Sbjct: 100 LDLSNNQLSGQIPASL-GALKALKLLNISCNKLSGKIPTSFGD-LENIETLDLSHNKLSGSIPQTLTKLQQLTILDVSNNQLTGRIPDV--GFANLSNLVDLDLSWNNFSGSIPPQLFHLPLLQDLSLDGNSLSGKIPEEIGNLSRLQVLSLSGNNFSGSIP 257

HSP 2
Score: 88.5817 bits (218), Expect = 1.73546e-18
Identity = 55/165 (33.33%), Postives = 87/165 (52.73%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
E+L L N TGE+P L + +L+ L++ +NSF G IP+ F + +LR + + N+L G IP+ + SG P +L L++L++SHN LSG IP + N++ L + N+ SG++P + L+ LD+S+N TG IPD
Sbjct: 495 ERLELQDNNLTGELPNFLSQIS-TLQVLNLRNNSFQGLIPESIF-NLSNLRILDVSSNNLTGEIPKD-DNLNIYTLLDLSNNQLSGQIPASLG---ALKALKLLNISHNKLSGKIPTSFGDLENIESLDMSHNKLSGSIPQTLTKLQQLTILDVSNNQLTGRIPD 653

HSP 3
Score: 87.8113 bits (216), Expect = 2.96025e-18
Identity = 53/162 (32.72%), Postives = 85/162 (52.47%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LSRN F+G P P L ++D SSN FSG++P F + RF++ GN G +P ++T +G+ P+F + ++ L+VL+L +N+ G IP+ I + NL+ L + N +G +P L + + LDLS+N +G IP
Sbjct: 428 LDLSRNRFSGPFPVFYPEV--QLAYIDFSSNDFSGEVPTTFPKET---RFLALGGNKFSGGLPLNLTNLSKLERLELQDNNLTGELPNFLS---QISTLQVLNLRNNSFQGLIPESIFNLSNLRILDVSSNNLTGEIPKDDNLNIY-TLLDLSNNQLSGQIP 580

HSP 4
Score: 76.6406 bits (187), Expect = 6.8245e-15
Identity = 52/178 (29.21%), Postives = 84/178 (47.19%), Query Frame = 2
Query:   32 TGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
TGE+P L + +L+ L++ +NSF G IP+ F + +LR + + N+L G IP+ + + ++ ++++ L LDLS+N LSG IP + + LK L + N+ SG +P G ++ LDLS N +GSIP TG +P
Sbjct: 12 TGELPNFLSQIS-TLQVLNLRNNSFQGLIPESIF-NLSNLRILDVSSNNLTGEIPKE-SQLPIHVEIEDLIVNWKNSKQGISSDHLNMYTL--LDLSNNQLSGQIPASLGALKALKLLNISCNKLSGKIPTSFGDLENIETLDLSHNKLSGSIPQTLTKLQQLTILDVSNNQLTGRIP 184

HSP 5
Score: 68.9366 bits (167), Expect = 1.42299e-12
Identity = 54/179 (30.17%), Postives = 79/179 (44.13%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSL-------------PNATCSLKFLDVSS-NSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
EKL L N TGEIP+ L T + ++ + N F+G +P FF ++ + N+ G IP+S+ RFSG FP F +L +D S N SG +P + + L L GN+FSG LP+ + L +L+L DN TG +P+
Sbjct: 344 EKLYLQNNLLTGEIPSWLFHFKGLRDLYLGGNRLTWNDSWISTQTDNEFTGSLPRPFFS------ILTLSENNFSGPIPQSLIKGPYLQLLDLSRNRFSGPFPVF----YPEVQLAYIDFSSNDFSGEVPT--TFPKETRFLALGGNKFSGGLPLNLTNLSKLERLELQDNNLTGELPN 510

HSP 6
Score: 52.7582 bits (125), Expect = 1.05531e-07
Identity = 46/178 (25.84%), Postives = 74/178 (41.57%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCS----LKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLR------------VLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L L N +G++ + N + S L+FLD+S N S +IP + ++ ++ + N L G IP S+ +G+ P + + L L + + N +G +P+ I L E N FSG +P + P+L LDLS N F+G P
Sbjct: 269 LYLDDNSLSGKVLAEIGNLSISSKGGLEFLDLSDNDLSTEIPTE-IGNLPNISTLALSNNRLTGGIPSSMQKLSKLEKLYLQNNLLTGEIPSWLFHFKGLRDLYLGGNRLTWNDSWISTQTDNEFTGSLPRPFFSILTLSE-----NNFSGPIPQSLIKGPYLQLLDLSRNRFSGPFP 440

GSVIVT010342830014.13e-2035.54%GSVIVT01034283001 assembled CDS
HSP 1
Score: 93.9745 bits (232), Expect = 4.13069e-20
Identity = 59/166 (35.54%), Postives = 87/166 (52.41%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCP--HLSKLDLSDNLFTGSIP 493
E L+LS N TG IP+S+ LK L +++N +G + + F S +L + + NSL G IP SI +G + + SL+ L +LDLS+N+ SG +P I L+ +LK L L GN+ +G+LP G C L +LDL+ N F G +P
Sbjct: 148 EILDLSYNSLTGIIPSSI-RLMSHLKSLSLAANHLNGYLQNQAFASLSNLEILDLSYNSLSGIIPSSIRLMSHLKSLSLAGNHLNGSLQN--QDFASLSNLEILDLSYNSFSGILPSSIRLMSSLKSLSLAGNQLNGSLP-NQGFCQLNKLQELDLNSNFFQGILP 309

HSP 2
Score: 83.5741 bits (205), Expect = 5.58279e-17
Identity = 62/190 (32.63%), Postives = 87/190 (45.79%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNR-------------------------FSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
E L+LS N TG IP+S+ LK L +++N +G + + F S +L + + NSL G IP SI +G + A + SL+ L +LDLS+N+LSG IP I L+ +LK L L GN FSG LP + L L L L+ N GS+P+
Sbjct: 99 EILDLSYNSLTGIIPSSI-RLMSHLKSLSLAANHLNGYLQNQDFASLSNLEILDLSYNSLTGIIPSSIRLMSHLKSLSLAANHLNGYLQNQA--FASLSNLEILDLSYNSLSGIIPSSIRLMSHLKSLSLAGNHLNGSLQNQDFASLSNLEILDLSYNSFSGILPSSIRLMSSLKSLSLAGNQLNGSLPN 285

HSP 3
Score: 81.6481 bits (200), Expect = 2.12146e-16
Identity = 57/165 (34.55%), Postives = 82/165 (49.70%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLP-VGMGLCPHLSKLDLSDNLFTGSIP 493
E L+LS N TG IP+S+ LK L +++N +G + + F S +L + + NSL G IP SI +G + + SL+ L +LDLS+N+L+G IP I L+ +LK L L N +G L +L LDLS N +G IP
Sbjct: 50 EILDLSYNSLTGIIPSSI-RLMSHLKSLSLAANHLNGSLQNQDFASLSNLEILDLSYNSLTGIIPSSIRLMSHLKSLSLAANHLNGYLQN--QDFASLSNLEILDLSYNSLTGIIPSSIRLMSHLKSLSLAANHLNGYLQNQAFASLSNLEILDLSYNSLSGIIP 211

HSP 4
Score: 77.7962 bits (190), Expect = 3.06338e-15
Identity = 56/176 (31.82%), Postives = 83/176 (47.16%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPD------------FANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E LNLS NGF G +P+S+ + SL LD+S+NSFSG++P + L F+ + N G I +F G + +++ + L LD+ N L G IP IS + L+ L+GN SG +P + +S +DLS+N F+GSIP
Sbjct: 466 EHLNLSNNGFEGILPSSIAEMS-SLWSLDLSANSFSGEVPKQLLVA-KDLEFLKLSNNKFHGEIFSRDFNLTSLEFLHLDNNQFKGTLSNHLHLQGNMFTGLIPRDFLNSSNLLTLDIRDNRLFGSIPNSISRLLELRIFLLRGNLLSGFIPNQLCHLTKISLMDLSNNNFSGSIP 639

HSP 5
Score: 73.9442 bits (180), Expect = 4.42351e-14
Identity = 53/162 (32.72%), Postives = 80/162 (49.38%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKL---DLSDNLF 478
E L+LS N +G IP+S+ LK L ++ N +G + + F S +L + + NS G +P SI + +G P+ G+ L +L+ LDL+ N G +P ++ + +L+ L L N FSGN V L P L+ L DLS NLF
Sbjct: 197 EILDLSYNSLSGIIPSSI-RLMSHLKSLSLAGNHLNGSLQNQDFASLSNLEILDLSYNSFSGILPSSIRLMSSLKSLSLAGNQLNGSLPN--QGFCQLNKLQELDLNSNFFQGILPPCLNNLTSLRLLDLSHNLFSGN--VSSSLLPSLTSLEYIDLSYNLF 353

HSP 6
Score: 63.929 bits (154), Expect = 4.57762e-11
Identity = 43/122 (35.25%), Postives = 58/122 (47.54%), Query Frame = 2
Query:  131 FESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLP-VGMGLCPHLSKLDLSDNLFTGSIP 493
F S +L + + NSL G IP SI +G + + SL+ L +LDLS+N+L+G IP I L+ +LK L L N +G L +L LDLS N TG IP
Sbjct: 43 FASLSNLEILDLSYNSLTGIIPSSIRLMSHLKSLSLAANHLNGSLQN--QDFASLSNLEILDLSYNSLTGIIPSSIRLMSHLKSLSLAANHLNGYLQNQDFASLSNLEILDLSYNSLTGIIP 162

HSP 7
Score: 63.929 bits (154), Expect = 4.57762e-11
Identity = 57/192 (29.69%), Postives = 80/192 (41.67%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIP-RSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFI--------------------------PKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
+ L+L+ N G + + +L+ LD+S NSFSG +P SL+ +S AGN L GS+P + F G P N +LT LR+LDLSHN SG + P G + LK L L + G+ P + L+ +DLS N TGS P+
Sbjct: 221 KSLSLAGNHLNGSLQNQDFASLSNLEILDLSYNSFSGILPSSI-RLMSSLKSLSLAGNQLNGSLPNQGFCQLNKLQELDLNSNFFQGILPPCLN---NLTSLRLLDLSHNLFSGNVSSSLLPSLTSLEYIDLSYNLFEETEYPVGWVPLFQLKVLVLSNYKLIGDFPGFLRYQFRLTVVDLSHNNLTGSFPN 408

HSP 8
Score: 62.003 bits (149), Expect = 1.73949e-10
Identity = 55/194 (28.35%), Postives = 76/194 (39.18%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP---------DF---------------------ANGYVS--LTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+L N FTG IP N++ +L LD+ N G IP+ LR GN L G IP + FSG P DF +N Y L + LDLS N L+G IP+ + ++ ++ L L N+ G++P + LDLS N +G IP
Sbjct: 555 LHLQGNMFTGLIPRDFLNSS-NLLTLDIRDNRLFGSIPNSISRLL-ELRIFLLRGNLLSGFIPNQLCHLTKISLMDLSNNNFSGSIPKCFGHIQFGDFKTEHNAHRDEVDEVEFVTKNRSNSYGGGILDFMSGLDLSCNNLTGEIPRELGMLSSILALNLSHNQLKGSVPKSFSKLSQIESLDLSYNKLSGEIP 746

HSP 9
Score: 51.2174 bits (121), Expect = 3.07049e-07
Identity = 42/162 (25.93%), Postives = 70/162 (43.21%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXR-FSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSI 490
++LS N TG P L L++L + +NS GQ+ + + + N L G + +++ F G P + ++ L LDLS N+ SG +PK + + +L+ LKL N+F G + L L L +N F G++
Sbjct: 395 VDLSHNNLTGSFPNWLLENNTRLEYLVLRNNSLMGQLLP--LRPNSRITSLDISDNRLVGELQQNVANMIPNIEHLNLSNNGFEGILP---SSIAEMSSLWSLDLSANSFSGEVPKQLLVAKDLEFLKLSNNKFHGEIFSRDFNLTSLEFLHLDNNQFKGTL 551

GSVIVT010160120014.13e-2037.42%GSVIVT01016012001 assembled CDS
HSP 1
Score: 93.9745 bits (232), Expect = 4.13069e-20
Identity = 61/163 (37.42%), Postives = 82/163 (50.31%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPN-ATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++LS N F G IP LPN S+ D+S+N FSG IP +S ++ F+S +GN + G+IP SI R +G P ++L VLDL +N LSG IPK + + L+ L L N SG LP L LDLS N +G+IP
Sbjct: 623 IDLSSNQFEGPIP--LPNPVVASVDVFDLSNNKFSGSIPLNIGDSIQAILFLSLSGNQITGTIPASIGFMWRVNAIDLSRNRLAGSIPSTIGNCLNLI---VLDLGYNNLSGMIPKSLGQLEWLQSLHLDHNNLSGALPASFQNLSSLETLDLSYNKLSGNIP 780

HSP 2
Score: 74.3294 bits (181), Expect = 3.38696e-14
Identity = 52/173 (30.06%), Postives = 81/173 (46.82%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFE--SCGSLRFVS------FAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
E L+L+ N G IP S N C L++L+V N+ +G +P+ E +C S R + N L G++P + + G P L++L L L +N L G IP + +H+LKE++L GN +G+LP G L LD+S N G++ +
Sbjct: 347 EILDLASNLLHGTIPNSFGNL-CKLRYLNVEGNNLTGSLPEFLEEIKNCSSKRLLPNLKNLILPQNHLIGNLPEWLGKLENLEELILDDNKLQGPIPASLG---RLSQLVELGLENNKLQGLIPASLGNLHHLKEMRLDGNNLNGSLPDSFGQLSELVTLDVSFNGLMGTLSE 515

HSP 3
Score: 73.1738 bits (178), Expect = 7.54537e-14
Identity = 56/178 (31.46%), Postives = 81/178 (45.51%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXR-FSGDFPDFANGYV-----------------SLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFT 481
E L+LS N +G IP + A +L+ L + SN FSG++P F + SL + A N+L GSIP +++ F PD A Y +L+ + +DLS N LSG PK I+ + L L L N +G++P + LS LDLS + T
Sbjct: 766 ETLDLSYNKLSGNIPRWIGTAFMNLRILKLRSNDFSGRLPSKF-SNLSSLHVLDLAENNLTGSIPSTLSDLKAMAQEGNVNKYLFYATSPDTAGEYYEESSDVSTKGQVLKYTKTLSLVVSIDLSSNNLSGEFPKEITALFGLVMLNLSRNHITGHIPENISRLHQLSSLDLSRKMTT 942

HSP 4
Score: 63.929 bits (154), Expect = 4.57762e-11
Identity = 44/141 (31.21%), Postives = 71/141 (50.35%), Query Frame = 2
Query:   74 LKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGI-SLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+++LD S+ S SG +P+ F+ ++ ++ + N +QG +P S+ +F G P N V+ + V DLS+N SG IP I I + L L GN+ +G +P +G ++ +DLS N GSIP
Sbjct: 572 VEYLDFSNASISGSLPNWFWNISFNMWVLNISLNQIQGQLP-SLLNVAEFGSIDLSSNQFEGPIP-LPNPVVA--SVDVFDLSNNKFSGSIPLNIGDSIQAILFLSLSGNQITGTIPASIGFMWRVNAIDLSRNRLAGSIP 708

HSP 5
Score: 53.1434 bits (126), Expect = 8.08025e-08
Identity = 41/152 (26.97%), Postives = 67/152 (44.08%), Query Frame = 2
Query:   71 SLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXR-FSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLP---------VGMGLCPHLSKLDLSDNLFTGSIPD 496
SL L++ N+F+ P G+ + SL+ + + ++L G IP I R S + G S ++ +LDL+ N L G IP + L+ L ++GN +G+LP L P+L L L N G++P+
Sbjct: 271 SLAILNIRGNNFNSTFP-GWLVNISSLKSIDISSSNLSGRIPLGIGELPNLQYLDLSWNRNLSCNCLHLLRG--SWKKIEILDLASNLLHGTIPNSFGNLCKLRYLNVEGNNLTGSLPEFLEEIKNCSSKRLLPNLKNLILPQNHLIGNLPE 419

GSVIVT010100520017.05e-2037.20%GSVIVT01010052001 assembled CDS
HSP 1
Score: 93.2041 bits (230), Expect = 7.04589e-20
Identity = 61/164 (37.20%), Postives = 81/164 (49.39%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
KL L NG +GEIP + N T SL L + SN F+GQIP +L F+ + N G IP I R G P + L L VLDLS N +SG +P+ + + +L +L L N +G +P +GLC L LD+S N TGSIP+
Sbjct: 289 KLLLISNGLSGEIPPDIGNCT-SLIRLRLGSNKFTGQIPPEI-GLLSNLSFLELSENQFTGEIPPDIGNCTQLEMVDLHGNRLQGTIP---TSFQFLVSLNVLDLSMNRMSGSVPENLGRLTSLNKLILNENYITGPIPNSLGLCKDLQFLDMSSNRITGSIPE 447

HSP 2
Score: 87.8113 bits (216), Expect = 2.96025e-18
Identity = 63/188 (33.51%), Postives = 88/188 (46.81%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP-DFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+L L N +G+IP S N +L+ L +S N+ SG+IP F S ++ + N L G IP +I + SG P + AN +L+ LDLSHN LSG +P + + NL +L L N SG +P +G C L +L L N FTG IP FTG++P
Sbjct: 169 QLELFDNQLSGKIPMSFANLG-ALEELLLSDNNISGKIPP-FIGSFSRMKQLELDNNLLSGEIPATIGQLKELSLFFAWQNQLSGSIPIELAN----CEKLQDLDLSHNFLSGSVPNSLFNLKNLTKLLLISNGLSGEIPPDIGNCTSLIRLRLGSNKFTGQIPPEIGLLSNLSFLELSENQFTGEIP 350

HSP 3
Score: 82.8037 bits (203), Expect = 9.5228e-17
Identity = 59/184 (32.07%), Postives = 82/184 (44.57%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRL---------------------RVLDLSHNALSGFIPKGISLIHNLKEL-KLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSI 490
+L L N FTG+IP + +L FL++S N F+G+IP +C L V GN LQG+IP S R SG P+ SL +L + LD+S N ++G IP+ I + L L L N SG +P +L+ LDLS N+ TGS+
Sbjct: 313 RLRLGSNKFTGQIPPEI-GLLSNLSFLELSENQFTGEIPPDI-GNCTQLEMVDLHGNRLQGTIPTSFQFLVSLNVLDLSMNRMSGSVPENLGRLTSLNKLILNENYITGPIPNSLGLCKDLQFLDMSSNRITGSIPEEIGRLQGLDILLNLSRNSLSGPVPESFSNLSNLANLDLSHNMLTGSL 494

HSP 4
Score: 59.3066 bits (142), Expect = 1.12751e-09
Identity = 46/140 (32.86%), Postives = 66/140 (47.14%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCS-LKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLP 421
KL L+ N TG IP SL C L+FLD+SSN +G IP+ G ++ + NSL G +P S + +L+ L LDLSHN L+G + + + + NL L + N FSG++P
Sbjct: 409 KLILNENYITGPIPNSL--GLCKDLQFLDMSSNRITGSIPEEIGRLQGLDILLNLSRNSLSGPVPES---------------------------FSNLSNLANLDLSHNMLTGSL-RVLGNLDNLVSLNVSYNNFSGSIP 518

HSP 5
Score: 55.0694 bits (131), Expect = 2.12638e-08
Identity = 39/121 (32.23%), Postives = 53/121 (43.80%), Query Frame = 2
Query:  140 CGSLRFVS---FAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
C S FVS + + P I +G+ P +L+ L VLDLS NAL+G IP I + L+ L L N G +P +G C L +L+L DN +G IP
Sbjct: 65 CSSAGFVSEITISSIDFHTTFPTQILSFNFLTTLVISDGNLTGEIPPSIG---NLSSLIVLDLSFNALTGKIPPAIGKLSELQLLLLNSNSIVGEIPREIGNCSKLRQLELFDNQLSGKIP 182

HSP 6
Score: 54.299 bits (129), Expect = 3.62706e-08
Identity = 49/196 (25.00%), Postives = 79/196 (40.31%), Query Frame = 2
Query:    8 LNLSRNGFTGEIP-------TSLPNATCSLKFLD---VSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+ S GF EI T+ P S FL +S + +G+IP + SL + + N+L G IP +I L+ L++L L+ N++ G IP+ I L++L+L N+ SG +P+ L +L LSDN +G IP + +G++P
Sbjct: 63 IKCSSAGFVSEITISSIDFHTTFPTQILSFNFLTTLVISDGNLTGEIPPSI-GNLSSLIVLDLSFNALTGKIPPAIG---------------------------KLSELQLLLLNSNSIVGEIPREIGNCSKLRQLELFDNQLSGKIPMSFANLGALEELLLSDNNISGKIPPFIGSFSRMKQLELDNNLLSGEIP 230

GSVIVT010173990011.20e-1939.16%GSVIVT01017399001 assembled CDS
HSP 1
Score: 92.4337 bits (228), Expect = 1.20185e-19
Identity = 65/166 (39.16%), Postives = 87/166 (52.41%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCP--HLSKLDLSDNLFTGSIP 493
++L+LS N F G +P L N T SL+ LD+SSN FSG + + SL ++ + N +GS S + F DFA SL+ L +LDLS+N+LSG IP I L+ LK L L GN +G+L G C L +LDLS NLF G +P
Sbjct: 407 QELDLSYNLFQGILPPCLNNLT-SLRLLDLSSNLFSGNLSSPLLPNLTSLEYIDLSYNHFEGSFSFSSFANHSNLQFLNLS---NNGFEDFA----SLSNLEILDLSYNSLSGIIPSSIRLMSCLKSLSLAGNHLNGSLQ-NQGFCQLNKLQELDLSYNLFQGILP 563

HSP 2
Score: 90.5077 bits (223), Expect = 4.56701e-19
Identity = 64/187 (34.22%), Postives = 89/187 (47.59%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCP--HLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDL 562
L LS N F GEI + N T L FL + +N F G + + +L + + NSL G IP SI F+G + + SL+ L +LDLS+N+ SG +P I L+ +LK L L GN +G+LP G C L +LDLS NLF G +P +F+G+L
Sbjct: 262 LKLSNNKFHGEIFSREFNLT-QLGFLHLDNNQFKGTLSNVISRISSNLEMLDLSYNSLSGIIPLSIRLMPHLKSLSLARNHFNGSLQN--QDFASLSNLELLDLSNNSFSGSVPSSIRLMSSLKSLSLAGNYLNGSLP-NQGFCQLNKLQELDLSYNLFQGILPPCLNNLTSLRLLDLSSNLFSGNL 444

HSP 3
Score: 78.1814 bits (191), Expect = 2.34555e-15
Identity = 56/165 (33.94%), Postives = 81/165 (49.09%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKL---DLSDNLFTGS 487
+ L+L+RN F G + + +L+ LD+S+NSFSG +P SL+ +S AGN L GS+P G+ L +L+ LDLS+N G +P ++ + +L+ L L N FSGNL L P+L+ L DLS N F GS
Sbjct: 333 KSLSLARNHFNGSLQNQDFASLSNLELLDLSNNSFSGSVPSS-IRLMSSLKSLSLAGNYLNGSLPN--------------------------QGFCQLNKLQELDLSYNLFQGILPPCLNNLTSLRLLDLSSNLFSGNL--SSPLLPNLTSLEYIDLSYNHFEGS 468

HSP 4
Score: 72.0182 bits (175), Expect = 1.68093e-13
Identity = 54/162 (33.33%), Postives = 73/162 (45.06%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L L N F G++P + ++FLDVS N+FSG +P +S L + GN G IPR DF N + L LD+ N L G IP IS + L+ L L GN SG +P + +S +DLS+N F+G IP
Sbjct: 836 LVLGNNNFKGKLPLEISQLQ-RMEFLDVSQNAFSGSLPS--LKSMEYLEHLHLQGNMFTGLIPR-----------------------DFLNS----SNLLTLDIRENRLFGSIPNSISALLKLRILLLGGNLLSGFIPNHLCHLTEISLMDLSNNSFSGPIP 967

HSP 5
Score: 71.2478 bits (173), Expect = 2.86724e-13
Identity = 55/177 (31.07%), Postives = 80/177 (45.20%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSI--------------PRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
LNLS NGF G +P+S+ +L LD+S+N+FSG++P + L + + N G I P I F G P + L R+ LD+S NA SG +P + + L+ L LQGN F+G +P +L LD+ +N GSIP+
Sbjct: 750 LNLSNNGFEGILPSSIAELR-ALWILDLSTNNFSGEVPKQLLAT-KDLGILKLSNNKFHGEIFSRDFNLTGLLCEIPSQIGNMTDLTTLVLGNNNFKGKLPLEIS---QLQRMEFLDVSQNAFSGSLPS-LKSMEYLEHLHLQGNMFTGLIPRDFLNSSNLLTLDIRENRLFGSIPN 920

HSP 6
Score: 69.707 bits (169), Expect = 8.34238e-13
Identity = 59/170 (34.71%), Postives = 80/170 (47.06%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHN---LKELKLQGNRFSGNLPVGMGLCPHLS---KLDLSDNLFTGSIP 493
++L+LS N F G +P L N T SL+ LD+SSN FSG + + SL ++ + N +GS S + GD P F + RL V+DLSHN L+G I L+ N L L L+ N G L P +S LDLS N F+G +P
Sbjct: 94 QELDLSYNLFQGILPPCLNNLT-SLRLLDLSSNLFSGNLSSPLLPNLTSLEYIDLSYNHFEGSFSFS-------SFANHSNLQLIGDLPSFLRHQL---RLTVVDLSHNNLTGSF--SIWLLENNTRLGSLVLRNNSLMGQLLPLRPNSPEMSSLQSLDLSANSFSGEVP 250

HSP 7
Score: 69.707 bits (169), Expect = 8.34238e-13
Identity = 59/182 (32.42%), Postives = 84/182 (46.15%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSL-PNATCSLKFLDVSSNSFSGQIP-----------------DGF--FESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNL--PVGMGLCPHLSKLDLSDNLFTGS 487
L+LS N F+G + + L PN T SL+++D+S N F G +GF F S +L + + NSL G IP SI +G + G+ L +L+ LDLS+N G +P ++ +L+ L L N FSGN P+ L L +DLS N F GS
Sbjct: 433 LDLSSNLFSGNLSSPLLPNLT-SLEYIDLSYNHFEGSFSFSSFANHSNLQFLNLSNNGFEDFASLSNLEILDLSYNSLSGIIPSSIRLMSCLKSLSLAGNHLNGSLQN--QGFCQLNKLQELDLSYNLFQGILPPCLNNFTSLRLLDLSSNLFSGNFSSPLLRNL-TSLEYIDLSSNQFEGS 610

HSP 8
Score: 65.4698 bits (158), Expect = 1.5733e-11
Identity = 48/178 (26.97%), Postives = 74/178 (41.57%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFI--------------PKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E L L N G++ PN + LD+S N GQ+ + ++ F++ + N +G +P SI FSG+ P ++ L +L LS+N G I P I + +L L L N F G LP+ + + LD+S N F+GS+P
Sbjct: 700 ESLVLRNNSLMGQLLPLGPNTR--INSLDISHNQLDGQLQENVAHMIPNIMFLNLSNNGFEGILPSSIAELRALWILDLSTNNFSGEVP---KQLLATKDLGILKLSNNKFHGEIFSRDFNLTGLLCEIPSQIGNMTDLTTLVLGNNNFKGKLPLEISQLQRMEFLDVSQNAFSGSLP 872

HSP 9
Score: 65.4698 bits (158), Expect = 1.5733e-11
Identity = 57/178 (32.02%), Postives = 80/178 (44.94%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGM--------------GLCPHLSKLDLSDNLFTGSIP 493
E L++S+N F+G +P+ + L+ L + N F+G IP F S +L + N L GSIP SI+ SG P N LT + ++DLS+N+ SG IPK I E+K + N F + G G+ +S LDLS N TG IP
Sbjct: 858 EFLDVSQNAFSGSLPSL--KSMEYLEHLHLQGNMFTGLIPRDFLNS-SNLLTLDIRENRLFGSIPNSISALLKLRILLLGGNLLSGFIP---NHLCHLTEISLMDLSNNSFSGPIPKCFGHI-RFGEMKKEDNVFGQFIEFGFGMFVTKNRSDFYKGGILEFMSGLDLSCNNLTGEIP 1028

HSP 10
Score: 54.6842 bits (130), Expect = 2.77714e-08
Identity = 53/212 (25.00%), Postives = 79/212 (37.26%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFV----------------------------SFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFA--------------NGYVSL-------TRLRVLDLSHNALSGFIPKGIS-LIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N F+G + L SL+++D+SSN F G F + L+ V S + L G +P + +G FP + N + TR+ LD+SHN L G + + ++ +I N+ L L N F G LP + L LDLS N F+G +P
Sbjct: 575 LDLSSNLFSGNFSSPLLRNLTSLEYIDLSSNQFEGSFSFSSFANHSKLQVVILGRDNNKFEVETEYPVGWVPLFQLKILSLSSCKLTGDLPGFLQYQFRLVGVDISHNNLTGSFPYWLLENNTRLESLVLRNNSLMGQLLPLGPNTRINSLDISHNQLDGQLQENVAHMIPNIMFLNLSNNGFEGILPSSIAELRALWILDLSTNNFSGEVP 786

GSVIVT010140370011.57e-1935.19%GSVIVT01014037001 assembled CDS
HSP 1
Score: 92.0485 bits (227), Expect = 1.56966e-19
Identity = 57/162 (35.19%), Postives = 80/162 (49.38%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LSR +G IP + + +L L++S N+F G P L F++ AGN+L G IP + +G P+ + SL L +L L +N L+G IP+GI + NL L L N +G LP +G L KLD+S N TGSIP
Sbjct: 102 LDLSRRNLSGTIPPEIRYLS-TLNHLNLSGNAFDGPFPPSDIIQLRYLEFLNLAGNALDGPIPPDYARLTALKSLDLSNNQLTGSIPE---QFTSLKELTILSLMNNELAGEIPQGIGDLPNLDTLSLWNNSLTGTLPQNLGSNAKLMKLDVSSNFLTGSIP 259

HSP 2
Score: 71.2478 bits (173), Expect = 2.86724e-13
Identity = 49/162 (30.25%), Postives = 73/162 (45.06%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+L N GEIP + + +L L + +NS +G +P S L + + N L GSIP ++ R + P+ SL R R L++S NA IP I L L L+ N +G +P + P ++ +DLS N TG+IP
Sbjct: 199 LSLMNNELAGEIPQGIGDLP-NLDTLSLWNNSLTGTLPQNL-GSNAKLMKLDVSSNFLTGSIPLNLCLGNHLIKLILFGNRLVSELPNSLANCTSLMRFRYLNISENAFDSHIPWDIGHCMKLLSLNLRDNSLTGIIPWEISTLPSITDVDLSHNFLTGTIP 358

GSVIVT010008190012.05e-1934.50%GSVIVT01000819001 assembled CDS
HSP 1
Score: 91.6633 bits (226), Expect = 2.05004e-19
Identity = 59/171 (34.50%), Postives = 78/171 (45.61%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFE--------SCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSI 490
E+L L N TGEIP + + SLK L SN+ + IP F CG L +S + N GSIPR I G+ P SL RL+V++LS N L G IP +S L+ L L+ N+ GN+P +G L L L+ N+ TG I
Sbjct: 151 EQLYLGGNQLTGEIPREISHLL-SLKILSFRSNNLTASIPSAIFNISSLQYIGKCGRLEEISLSFNEFMGSIPRGIGSLSVLEVLYLGSNNLEGEIPQTLFNLSSLPRLQVINLSQNQLKGEIPPSLSNCGELQTLYLEKNKIQGNIPKELGHLSELQYLSLASNILTGGI 320

HSP 2
Score: 63.929 bits (154), Expect = 4.57762e-11
Identity = 60/190 (31.58%), Postives = 79/190 (41.58%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSI-PRSI---TXXXXXXXXXXXXXRFSGDFPDFAN------------GYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPH-----------LSKLDLSDNLFTGSIPD 496
+NLS+N GEIP SL N L+ L + N G IP L+++S A N L G I P SI T F G F N G +LT L L L N L+G IP + + L+ L + GNR G++P G+G + L L++S N G IPD
Sbjct: 261 INLSQNQLKGEIPPSLSNCG-ELQTLYLEKNKIQGNIPKELGH-LSELQYLSLASNILTGGIIPASISNITKLTRLDLSYNLLTGFLGFLTSFINASACQFKGVIPAGIGNLTNLIELGLGDNDLTGMIPTTLGQLKKLQRLYIAGNRIHGSVPNGIGHLANLVYLFLKALVSLKYLNVSFNKLEGEIPD 448

HSP 3
Score: 60.8474 bits (146), Expect = 3.87518e-10
Identity = 52/171 (30.41%), Postives = 76/171 (44.44%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLK---------ELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS G I + N + L LD+S+NSF IP+ + C LR + N L GSIP++I + +G+ P + +SL ++L N L+ IP I I +L+ E+ L N F G++P G+G L L L N G IP
Sbjct: 81 LDLSNMDLEGTIAPQVGNLSF-LVTLDLSNNSFHASIPNEIAK-CRELRQLYLFNNRLTGSIPQAIGNLSKLEQLYLGGNQLTGEIPREISHLLSL---KILSFRSNNLTASIPSAIFNISSLQYIGKCGRLEEISLSFNEFMGSIPRGIGSLSVLEVLYLGSNNLEGEIP 246

GSVIVT010296460013.50e-1935.80%GSVIVT01029646001 assembled CDS
HSP 1
Score: 90.8929 bits (224), Expect = 3.49684e-19
Identity = 58/162 (35.80%), Postives = 77/162 (47.53%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L LS N TG IP+++ + +L FL +S N +G IP ES L F+S +GN + G+IP SI G P N + + L VLDL +N L G IPK + + +L+ L L N SG LP L LDLS N G +P
Sbjct: 666 LLLSDNQITGAIPSNIGESLPNLIFLSLSGNQITGAIPSNIGESLPGLYFLSLSGNQITGTIPDSIGRITYLEVIDFSRNNLIGSIPSTIN---NCSNLFVLDLGNNNLFGIIPKSLGQLQSLQSLHLNHNELSGELPSSFQNLTGLEVLDLSYNKLLGEVP 824

HSP 2
Score: 79.7221 bits (195), Expect = 8.06153e-16
Identity = 54/163 (33.13%), Postives = 77/163 (47.24%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSI-TXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N F+ IP S + L++L +S N +G IP ES +L F+S +GN + G+IP +I + +G PD +T L V+D S N L G IP I+ NL L L N G +P +G L L L+ N +G +P
Sbjct: 641 LDLSHNKFSVPIPLSRGESMLDLRYLLLSDNQITGAIPSNIGESLPNLIFLSLSGNQITGAIPSNIGESLPGLYFLSLSGNQITGTIPDSIG---RITYLEVIDFSRNNLIGSIPSTINNCSNLFVLDLGNNNLFGIIPKSLGQLQSLQSLHLNHNELSGELP 800

HSP 3
Score: 79.337 bits (194), Expect = 1.05287e-15
Identity = 58/163 (35.58%), Postives = 79/163 (48.47%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGI-SLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N TG IP S+ T L+ +D S N+ G IP +C +L + N+L G IP+S+ SG+ P + + +LT L VLDLS+N L G +P I + NL L L+ N F G LP + L LDL+ N G IP
Sbjct: 716 LSLSGNQITGTIPDSIGRITY-LEVIDFSRNNLIGSIPSTI-NNCSNLFVLDLGNNNLFGIIPKSLGQLQSLQSLHLNHNELSGELP---SSFQNLTGLEVLDLSYNKLLGEVPAWIGAAFVNLVILNLRSNVFCGRLPSRLSNLSSLHVLDLAQNNLMGEIP 873

HSP 4
Score: 68.5514 bits (166), Expect = 1.85849e-12
Identity = 58/202 (28.71%), Postives = 85/202 (42.08%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDF--------ANGYVSLTRLRVL------DLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E L+LS N GE+P + A +L L++ SN F G++P + SL + A N+L G IP ++ + + + A G SL R L DLS N LSG P+ I+ + L L L N +G +P + + LS LDLS N +G+IP F G++P
Sbjct: 810 EVLDLSYNKLLGEVPAWIGAAFVNLVILNLRSNVFCGRLPSRL-SNLSSLHVLDLAQNNLMGEIPITLVELKAMAQEQMNIYWLNENANSWYEERLVVIAKGQ-SLEYTRTLSLVVGIDLSDNNLSGEFPQEITKLFGLVVLNLSRNHITGQIPENISMLRQLSSLDLSSNKLSGTIPSSMASLSFLSYLNLSNNNFYGEIP 1009

HSP 5
Score: 68.1662 bits (165), Expect = 2.42726e-12
Identity = 59/209 (28.23%), Postives = 86/209 (41.15%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSL--------------------PNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSI-TXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
++LNLS N G++P SL P + + FLD+S N FS IP ES LR++ + N + G+IP +I + +G P +N SL L L LS N ++G IP I I L+ + N G++P + C +L LDL +N G IP +G+LP
Sbjct: 594 QRLNLSHNQLQGQLPNSLKFHYGESEIDFSSNLFEGPIPFSIKGVYFLDLSHNKFSVPIPLSRGESMLDLRYLLLSDNQITGAIPSNIGESLPNLIFLSLSGNQITGAIP--SNIGESLPGLYFLSLSGNQITGTIPDSIGRITYLEVIDFSRNNLIGSIPSTINNCSNLFVLDLGNNNLFGIIPKSLGQLQSLQSLHLNHNELSGELP 800

HSP 6
Score: 67.781 bits (164), Expect = 3.1701e-12
Identity = 51/170 (30.00%), Postives = 75/170 (44.12%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSN-SFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVS------LTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
+++S N G IP L +L++LD+S N + I +S + ++ A N L GSIP SI +G P+ G + L L L L N L G +P + + NL+ L L GN+F G +P + HL + LS N GS+PD
Sbjct: 319 IDISHNQLHGRIPLGLGELP-NLQYLDLSWNFNLRRSISQLLRKSWKKIEVLNLARNELHGSIPSSIGNFCNLKYLDLGFNLLNGSLPEIIKGLETCRSKSPLPNLTELYLHRNQLMGTLPNWLGELKNLRVLALSGNKFEGPIPFFLWTLQHLEYMYLSWNELNGSLPD 487

HSP 7
Score: 65.4698 bits (158), Expect = 1.5733e-11
Identity = 49/144 (34.03%), Postives = 74/144 (51.39%), Query Frame = 2
Query:   71 SLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIP--KGISLIHNLKELKLQGNRFSGNLPVGMG-LCPHLSKLDLSDNLFTGSIP 493
+L+ LD S++S S IPD F+ +L+ ++ + N LQG +P S+ F G P S+ + LDLSHN S IP +G S++ +L+ L L N+ +G +P +G P+L L LS N TG+IP
Sbjct: 567 NLEDLDFSNDSISSPIPDWFWNISLNLQRLNLSHNQLQGQLPNSLKFHYGESEIDFSSNLFEGPIP------FSIKGVYFLDLSHNKFSVPIPLSRGESML-DLRYLLLSDNQITGAIPSNIGESLPNLIFLSLSGNQITGAIP 703

HSP 8
Score: 61.6178 bits (148), Expect = 2.27185e-10
Identity = 51/173 (29.48%), Postives = 76/173 (43.93%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGF--FESCGS------LRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
E LNL+RN G IP+S+ N C+LK+LD+ N +G +P+ E+C S L + N L G++P N L LRVL LS N G IP + + +L+ + L N +G+LP +G L L + N +GS+ +
Sbjct: 367 EVLNLARNELHGSIPSSIGN-FCNLKYLDLGFNLLNGSLPEIIKGLETCRSKSPLPNLTELYLHRNQLMGTLP---------------------------NWLGELKNLRVLALSGNKFEGPIPFFLWTLQHLEYMYLSWNELNGSLPDSVGQLSQLQGLGVGSNHMSGSLSE 511

HSP 9
Score: 57.7658 bits (138), Expect = 3.28054e-09
Identity = 51/176 (28.98%), Postives = 83/176 (47.16%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSS-------NSFSGQIPDGFFESCG-----------SLRFVS--FAGNSLQGSIPRSITXXXXXXXXXXXXX-RFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDN 472
LNLS GF+G IP++L N + SL++LD+SS + + I +F + SL+++S + SL GS + SG FP + +V+LT L V+ ++ N + P + + NL + + N+ G +P+G+G P+L LDLS N
Sbjct: 176 LNLSSAGFSGSIPSNLRNLS-SLQYLDLSSEYLDDIDSMYLYDIDSEYFNNLFVENIEWMTDLVSLKYLSMNYVNLSLVGSQWVEVANKLPSLTELHLGGCSLSGSFP--SPSFVNLTSLAVIAINSNHFNSKFPNWLLNVSNLVSIDISHNQLHGRIPLGLGELPNLQYLDLSWN 348

GSVIVT010188140015.96e-1931.38%GSVIVT01018814001 assembled CDS
HSP 1
Score: 90.1225 bits (222), Expect = 5.9647e-19
Identity = 59/188 (31.38%), Postives = 88/188 (46.81%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E LNL N +G IP L + +L LD+S N SG+IP + L ++ +GN+ G IP ++ + SG+ PD +G L L+++ L N LSG +P+G S + +L+ L L N FSG++P G + L LS+NL G IP +GD+P
Sbjct: 312 ETLNLRHNNLSGTIPEELLRLS-NLTTLDLSWNKLSGEIPANI-GNLSKLLVLNISGNAYSGKIPATVGNLFKLTTLDLSKQKLSGEVPDELSG---LPNLQLIALQENMLSGDVPEGFSSLVSLRYLNLSSNSFSGHIPATFGFLQSVVVLSLSENLIGGLIPSEIGNCSELRVLELGSNSLSGDIP 494

HSP 2
Score: 85.5001 bits (210), Expect = 1.46916e-17
Identity = 53/162 (32.72%), Postives = 85/162 (52.47%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+NLS N F+GEIP + A L++L + N G +P +C +L +S GN+L+G +P +I SG P ++ + +++ LR++ L NA + IP+ + L+ L L+GN+FSG +P +G L L L +NLF+G IP
Sbjct: 145 INLSYNDFSGEIPVTF-GALQQLQYLWLDYNFLDGTLPSAI-ANCSALIHLSVEGNALRGVVPVAIASLPKLQVISLSHNNLSGAVP--SSMFCNVSSLRIVQLGFNAFTDIIPEELRKCSYLRVLDLEGNQFSGAVPAFLGDLTSLKTLSLGENLFSGLIP 302

HSP 3
Score: 82.4185 bits (202), Expect = 1.24372e-16
Identity = 61/187 (32.62%), Postives = 80/187 (42.78%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCS-LKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+ L N FT IP L CS L+ LD+ N FSG +P F SL+ +S N G IP SG P+ + L+ L LDLS N LSG IP I + L L + GN +SG +P +G L+ LDLS +G +PD M +GD+P
Sbjct: 242 VQLGFNAFTDIIPEELRK--CSYLRVLDLEGNQFSGAVP-AFLGDLTSLKTLSLGENLFSGLIPPIFGKLSQLETLNLRHNNLSGTIPE---ELLRLSNLTTLDLSWNKLSGEIPANIGNLSKLLVLNISGNAYSGKIPATVGNLFKLTTLDLSKQKLSGEVPDELSGLPNLQLIALQENMLSGDVP 422

HSP 4
Score: 82.0333 bits (201), Expect = 1.62434e-16
Identity = 55/186 (29.57%), Postives = 85/186 (45.70%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+LS+ +GE+P L +L+ + + N SG +P+GF S SLR+++ + NS G IP + G P + + LRVL+L N+LSG IP +S + +L EL L N +G +P + C L+ L L N +G IP+ TG++P
Sbjct: 386 LDLSKQKLSGEVPDELSGLP-NLQLIALQENMLSGDVPEGF-SSLVSLRYLNLSSNSFSGHIPATFGFLQSVVVLSLSENLIGGLIPSEIG---NCSELRVLELGSNSLSGDIPADLSRLSHLNELNLGRNNLTGEIPEEISKCSALTSLLLDTNHLSGHIPNSLSNLSNLTTLDLSTNNLTGEIP 566

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CF810502
Best 10 Hits Shown

Match Name E value Identity Description
AT3G28040.1 3.38e-3945.21%
Leucine-rich receptor-like protein kina...
HSP 1
Score: 157.918 bits (398), Expect = 3.37647e-39
Identity = 85/188 (45.21%), Postives = 116/188 (61.70%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+KL+LS N +G+IP+SL + T SL+ LD++ NSFSG + D F +C SLR++S + N L+G IP ++ RFSG+ P F +G L RLR LDLS N+LSG IP GI +HNLKEL+LQ N+FSG LP +GLCPHL+++DLS N F+G +P + +GD P
Sbjct: 127 QKLDLSHNNLSGQIPSSLGSIT-SLQHLDLTGNSFSGTLSDDLFNNCSSLRYLSLSHNHLEGQIPSTLFRCSVLNSLNLSRNRFSGN-PSFVSGIWRLERLRALDLSSNSLSGSIPLGILSLHNLKELQLQRNQFSGALPSDIGLCPHLNRVDLSSNHFSGELPRTLQKLKSLNHFDVSNNLLSGDFP 312

HSP 2
Score: 91.2781 bits (225), Expect = 3.88114e-19
Identity = 64/184 (34.78%), Postives = 86/184 (46.74%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPR-SITXXXXXXXXXXXXXRFSGDFPDFANGYVS---------------------LTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
LNLS N +GE+P SL + L + + N FSG IPDGFF+ L+ + F+GN L GSIPR S +G P ++ L L VLDL ++AL G +P I +L+ L+L GN +G++P G+G C L L LS N TG IP
Sbjct: 348 LNLSENKLSGEVPESLESCK-ELMIVQLKGNDFSGNIPDGFFDL--GLQEMDFSGNGLTGSIPRGSSRLFESLIRLDLSHNSLTGSIPGEVGLFIHMRYLNLSWNHFNTRVPPEIEFLQNLTVLDLRNSALIGSVPADICESQSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIP 528

HSP 3
Score: 86.2705 bits (212), Expect = 1.24852e-17
Identity = 55/163 (33.74%), Postives = 79/163 (48.47%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L+LS N +G IP + + +LK L + N FSG +P C L V + N G +PR++ SGDFP + +T L LD S N L+G +P IS + +LK+L L N+ SG +P + C L + L N F+G+IPD
Sbjct: 228 LDLSSNSLSGSIPLGILSLH-NLKELQLQRNQFSGALPSDI-GLCPHLNRVDLSSNHFSGELPRTLQKLKSLNHFDVSNNLLSGDFPPWIG---DMTGLVHLDFSSNELTGKLPSSISNLRSLKDLNLSENKLSGEVPESLESCKELMIVQLKGNDFSGNIPD 385

HSP 4
Score: 77.7962 bits (190), Expect = 4.44059e-15
Identity = 50/163 (30.67%), Postives = 84/163 (51.53%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+L+LS N TG IP + +++L++S N F+ ++P E +L + ++L GS+P I +G P+ G + + L++L LSHN L+G IPK +S + LK LKL+ N+ SG +P +G +L +++S N G +P
Sbjct: 419 RLDLSHNSLTGSIPGEV-GLFIHMRYLNLSWNHFNTRVPPEI-EFLQNLTVLDLRNSALIGSVPADICESQSLQILQLDGNSLTGSIPE---GIGNCSSLKLLSLSHNNLTGPIPKSLSNLQELKILKLEANKLSGEIPKELGDLQNLLLVNVSFNRLIGRLP 576

HSP 5
Score: 63.929 bits (154), Expect = 6.63559e-11
Identity = 46/140 (32.86%), Postives = 66/140 (47.14%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVG 427
LNLS N F +P + +L LD+ +++ G +P ES SL+ + GNSL GSIP I +G P + +L L++L L N LSG IPK + + NL + + NR G LP+G
Sbjct: 444 LNLSWNHFNTRVPPEIEFLQ-NLTVLDLRNSALIGSVPADICES-QSLQILQLDGNSLTGSIPEGIGNCSSLKLLSLSHNNLTGPIPKSLS---NLQELKILKLEANKLSGEIPKELGDLQNLLLVNVSFNRLIGRLPLG 578

HSP 6
Score: 56.6102 bits (135), Expect = 1.05939e-08
Identity = 41/113 (36.28%), Postives = 51/113 (45.13%), Query Frame = 2
Query:  158 VSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGM-GLCPHLSKLDLSDNLFTGSIP 493
+S G +L G I R I F+G+ +N L+ LDLSHN LSG IP + I +L+ L L GN FSG L + C L L LS N G IP
Sbjct: 82 LSLDGLALTGKINRGIQKLQRLKVLSLSNNNFTGNINALSNN----NHLQKLDLSHNNLSGQIPSSLGSITSLQHLDLTGNSFSGTLSDDLFNNCSSLRYLSLSHNHLEGQIP 190

AT5G01890.1 5.40e-2942.94%
Leucine-rich receptor-like protein kina...
HSP 1
Score: 124.02 bits (310), Expect = 5.40313e-29
Identity = 70/163 (42.94%), Postives = 93/163 (57.06%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L LS N TG + P+ SL+ +D S N+ SG+IPDGFFE CGSLR VS A N L GSIP S++ + SG P L L+ LD SHN L G IP G+ +++L+ + L N FSG++P +G C L LDLS+N F+G++PD
Sbjct: 97 LVLSNNNLTGTLNPEFPHLG-SLQVVDFSGNNLSGRIPDGFFEQCGSLRSVSLANNKLTGSIPVSLSYCSTLTHLNLSSNQLSGRLP---RDIWFLKSLKSLDFSHNFLQGDIPDGLGGLYDLRHINLSRNWFSGDVPSDIGRCSSLKSLDLSENYFSGNLPD 255

HSP 2
Score: 82.0333 bits (201), Expect = 2.3546e-16
Identity = 57/165 (34.55%), Postives = 83/165 (50.30%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLR---FVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS NGFTGE+P+++ T SL L++S+NS G IP G G L+ + + N L G++P I R SG P + + + L ++LS N LSG IP I + NL+ + L N SG+LP + HL ++S N TG +P
Sbjct: 390 LDLSSNGFTGELPSNIWILT-SLLQLNMSTNSLFGSIPTGI----GGLKVAEILDLSSNLLNGTLPSEIGGAVSLKQLHLHRNRLSGQIPAKIS---NCSALNTINLSENELSGAIPGSIGSLSNLEYIDLSRNNLSGSLPKEIEKLSHLLTFNISHNNITGELP 546

HSP 3
Score: 73.9442 bits (180), Expect = 6.4122e-14
Identity = 57/189 (30.16%), Postives = 81/189 (42.86%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFF----ESCG-----------------------SLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
LNLS N GE+P +L N + +L +DVS NSF+G + F ES LR + + N G +P +I G P G L +LDLS N L+G +P I +LK+L L NR SG +P + C L+ ++LS+N +G+IP
Sbjct: 314 LNLSANMLAGELPQTLSNCS-NLISIDVSKNSFTGDVLKWMFTGNSESSSLSRFSLHKRSGNDTIMPIVGFLQGLRVLDLSSNGFTGELPSNIWILTSLLQLNMSTNSLFGSIP---TGIGGLKVAEILDLSSNLLNGTLPSEIGGAVSLKQLHLHRNRLSGQIPAKISNCSALNTINLSENELSGAIP 498

HSP 4
Score: 64.6994 bits (156), Expect = 3.89015e-11
Identity = 45/141 (31.91%), Postives = 63/141 (44.68%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVG 427
+LN+S N G IPT + + + LD+SSN +G +P SL+ + N L G IP I+ SG P SL+ L +DLS N LSG +PK I + +L + N +G LP G
Sbjct: 413 QLNMSTNSLFGSIPTGIGGLKVA-EILDLSSNLLNGTLPSE-IGGAVSLKQLHLHRNRLSGQIPAKISNCSALNTINLSENELSGAIP---GSIGSLSNLEYIDLSRNNLSGSLPKEIEKLSHLLTFNISHNNITGELPAG 548

HSP 5
Score: 54.6842 bits (130), Expect = 4.02567e-08
Identity = 38/118 (32.20%), Postives = 55/118 (46.61%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKG 355
E L+LS N G +P+ + A SLK L + N SGQIP +C +L ++ + N L G+IP SI SG P L+ L ++SHN ++G +P G
Sbjct: 436 EILDLSSNLLNGTLPSEIGGAV-SLKQLHLHRNRLSGQIP-AKISNCSALNTINLSENELSGAIPGSIGSLSNLEYIDLSRNNLSGSLPKEIE---KLSHLLTFNISHNNITGELPAG 548

AT3G56370.1 2.68e-2843.29%
Leucine-rich repeat protein kinase fami...
HSP 1
Score: 121.709 bits (304), Expect = 2.68155e-28
Identity = 71/164 (43.29%), Postives = 92/164 (56.10%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
KL+LS N TG I ++ + +LK +D+SSN SG +PD FF CGSLR +S A N L G IP SI+ FSG P G SL LR LDLS N L G P+ I ++NL+ L L NR SG +P +G C L +DLS+N +GS+P+
Sbjct: 97 KLSLSNNNLTGIINPNMLLSLVNLKVVDLSSNGLSGSLPDEFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNGFSGSMP---LGIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCMLLKTIDLSENSLSGSLPN 257

HSP 2
Score: 90.5077 bits (223), Expect = 6.62022e-19
Identity = 60/176 (34.09%), Postives = 86/176 (48.86%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFA--------------NGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
LNL +N GE+P + SL+ LD+S N FSGQ+PD +L+ ++F+GN L GS+P S +G P + N + +++VLDLSHNA SG I G+ + +L+ L L N +G +P +G HLS LD+S N G IP
Sbjct: 268 LNLGKNALEGEVPKWIGEMR-SLETLDLSMNKFSGQVPDSIGNLL-ALKVLNFSGNGLIGSLPVSTANCINLLALDLSGNSLTGKLPMWLFQDGSRDVSALKNDNSTGGIKKIQVLDLSHNAFSGEIGAGLGDLRDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHNQLNGMIP 441

HSP 3
Score: 75.485 bits (184), Expect = 2.20384e-14
Identity = 56/176 (31.82%), Postives = 78/176 (44.32%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVS--------------LTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
LN S NG G +P S N +L LD+S NS +G++P F+ GS + ++ G I + GD D ++S L L VLD+SHN L+G IP+ +L+EL+L+ N GN+P + C L L LS N GSIP
Sbjct: 316 LNFSGNGLIGSLPVSTANCI-NLLALDLSGNSLTGKLPMWLFQD-GSRDVSALKNDNSTGGIKKIQVLDLSHNAFSGEIGAGLGDLRDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHNQLNGMIPRETGGAVSLEELRLENNLLEGNIPSSIKNCSSLRSLILSHNKLLGSIP 489

HSP 4
Score: 68.9366 bits (167), Expect = 2.06273e-12
Identity = 55/159 (34.59%), Postives = 74/159 (46.54%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCG--SLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDN 472
E L+LSRN TG IP+++ L LDVS N +G IP E+ G SL + N L+G+IP SI + G P LTRL +DLS N L+G +PK ++ + L + N G LP G G+ LS +S N
Sbjct: 403 EGLHLSRNSLTGPIPSTIGELK-HLSVLDVSHNQLNGMIPR---ETGGAVSLEELRLENNLLEGNIPSSIKNCSSLRSLILSHNKLLGSIPP---ELAKLTRLEEVDLSFNELAGTLPKQLANLGYLHTFNISHNHLFGELPAG-GIFNGLSPSSVSGN 553

AT4G39400.1 1.43e-2139.02%
Leucine-rich receptor-like protein kina...
HSP 1
Score: 99.3673 bits (246), Expect = 1.42518e-21
Identity = 64/164 (39.02%), Postives = 86/164 (52.44%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++L L NGFTG+IP +L N + L L +S N SG IP S LR + N L+G IP+ + +G+ P +G + T L + LS+N L+G IPK I + NL LKL N FSGN+P +G C L LDL+ NLF G+IP
Sbjct: 419 QELYLQNNGFTGKIPPTLSNCS-ELVSLHLSFNYLSGTIPSSL-GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIP---SGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIP 577

HSP 2
Score: 85.5001 bits (210), Expect = 2.12965e-17
Identity = 64/193 (33.16%), Postives = 89/193 (46.11%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPR-SITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLR----VLDLSHNALSGFIPKGI--SLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+L+ N FTGEIP L A +L LD+S N F G +P FF SC L ++ + N+ G +P ++ FSG+ P+ SLT L LDLS N SG I + + + L+EL LQ N F+G +P + C L L LS N +G+IP M G++P
Sbjct: 296 LSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPP-FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE------SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIP 481

HSP 3
Score: 77.411 bits (189), Expect = 5.79959e-15
Identity = 58/211 (27.49%), Postives = 90/211 (42.65%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXR--FSGDFP----------------DFANGYV-----SLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E L LS N F+GE+P LK LD+S N FSG++P+ SL + + N+ G I ++ F+G P ++ +G + SL++LR L L N L G IP+ + + L+ L L N +G +P G+ C +L+ + LS+N TG IP F+G++P
Sbjct: 343 ESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIP 553

HSP 4
Score: 66.6254 bits (161), Expect = 1.02372e-11
Identity = 56/191 (29.32%), Postives = 83/191 (43.46%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCS-LKFLDVSSNS--FSGQIPDGF-------------------------FESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L+LSRN +G + T +CS LKFL+VSSN+ F G++ G + CG L+ ++ +GN + G + ++ FS P + + L+ LD+S N LSG + IS LK L + N+F G +P L L L++N FTG IPD
Sbjct: 127 LDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDV--DVSRCVNLEFLDVSSNNFSTGIPFLGD----CSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLP--LKSLQYLSLAENKFTGEIPD 309

HSP 5
Score: 66.2402 bits (160), Expect = 1.33703e-11
Identity = 59/205 (28.78%), Postives = 86/205 (41.95%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSL--------RFVSF-----------AGNSL--QGSIPRSITXXXXXXXXXXXXXRFSGDF-PDFAN---------------GYV-----SLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L LS N F+G IP L + SL +LD+++N F+G IP F+ G + R+V AGN L QG + + G P F N GY+ S+ L +L+L HN +SG IP + + L L L N+ G +P M L+++DLS+N +G IP+
Sbjct: 541 LKLSNNSFSGNIPAELGDCR-SLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE 744

AT3G11080.1 5.42e-2136.26%
receptor like protein 35 | chr3:3470481...
HSP 1
Score: 97.4413 bits (241), Expect = 5.41568e-21
Identity = 66/182 (36.26%), Postives = 89/182 (48.90%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPD-FAN--------------------GYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSI 490
L+LS N F+G+IP+S+ N + L L++SSN FSGQIP + +L F+S N G IP SI F G+ P F N ++LTRL L LSHN +G IP ISL+ NL + + N F+G LP + P L +LDLSDN G++
Sbjct: 178 LHLSSNQFSGQIPSSIGNLS-HLTSLELSSNQFSGQIPSSI-GNLSNLTFLSLPSNDFFGQIPSSIGNLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLNGTL 357

HSP 2
Score: 87.4261 bits (215), Expect = 5.60435e-18
Identity = 64/186 (34.41%), Postives = 84/186 (45.16%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+LS N F G IP+S+ N + L L +SSN FSGQIP + L + + N G IP SI F G P +L RL L LS+N G IP ++ L L++ N+ SGN+P+ + LS L LS N FTG+IP+ FTG LP
Sbjct: 154 LHLSYNQFLGLIPSSIENLS-RLTSLHLSSNQFSGQIPSSI-GNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSNDFFGQIPSSIG---NLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTLP 334

HSP 3
Score: 64.6994 bits (156), Expect = 3.89015e-11
Identity = 58/249 (23.29%), Postives = 88/249 (35.34%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLT-------------------RLRVLDLSHNALSGFIP---------------------------------------KGIS-----LIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+LS N + G IP + +L L++ N+ SG +P FES LR + N L G +PRS+ R + FP + + L LR++D+SHN +G +P KG++ ++ L GN+F G +P +GL L L+LS+N F G IP TG++P
Sbjct: 574 LDLSENNYNGSIPRCMEKLKSTLFVLNLRQNNLSGGLPKHIFES---LRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNAFHGPIHEATFPELRIIDISHNHFNGTLPTEYFVKWSAMSSLGKNEDQSNEKYMGSGLYYQDSMVLMNKGLAMELVRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEIP 819

HSP 4
Score: 59.6918 bits (143), Expect = 1.25142e-09
Identity = 47/149 (31.54%), Postives = 59/149 (39.60%), Query Frame = 2
Query:   65 TCSLKFLDVSSNSFSGQIPDGFFESCGSL------RFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
TC K +V S G F S SL R + N L G IP SI +L+ L L LS+N G IP I + L L L N+FSG +P +G HL+ L+LS N F+G IP
Sbjct: 93 TCDTKSGEVIELDLSCSWLYGSFHSNSSLFRLQNLRVLDLTQNDLDGEIPSSIG---------------------------NLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIP 214

HSP 5
Score: 59.3066 bits (142), Expect = 1.6344e-09
Identity = 51/181 (28.18%), Postives = 70/181 (38.67%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSI-----TXXXXXXXXXXXXXRFSGDFPDFANGYVS------------LTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E LN+ N P L + + L+ L + SN+F G I + F LR + + N G++P ++ G + + V LT LD S N G IPK I L+ L L L N F G++P MG L LD+S N TG IP
Sbjct: 643 EVLNVESNRINDTFPFWLSSLS-KLQVLVLRSNAFHGPIHEATFPE---LRIIDISHNHFNGTLPTEYFVKWSAMSSLGKNEDQSNEKYMGSGLYYQDSMVLMNKGLAMELVRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEIP 819

HSP 6
Score: 55.0694 bits (131), Expect = 3.08235e-08
Identity = 47/148 (31.76%), Postives = 65/148 (43.92%), Query Frame = 2
Query:   74 LKFLDVSSNSFSGQI-------PDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGI-SLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L FLDVS+N GQ+ P+ F+ + + F+SF +S + + S F+G P F G L L LDLS N +G IP+ + L L L L+ N SG LP + L LD+ NL G +P
Sbjct: 493 LGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFISFESSSKKHGL--SSVRKPSMIHLFASNNNFTGKIPSFICG---LRSLNTLDLSENNYNGSIPRCMEKLKSTLFVLNLRQNNLSGGLP--KHIFESLRSLDVGHNLLVGKLP 633

HSP 7
Score: 53.9138 bits (128), Expect = 6.86676e-08
Identity = 32/91 (35.16%), Postives = 42/91 (46.15%), Query Frame = 2
Query:  293 LTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L LRVLDL+ N L G IP I + +L L L N+F G +P + L+ L LS N F+G IP F+G +P
Sbjct: 124 LQNLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIP 214

AT4G36180.1 7.07e-2138.41%
Leucine-rich receptor-like protein kina...
HSP 1
Score: 97.0561 bits (240), Expect = 7.0731e-21
Identity = 63/164 (38.41%), Postives = 91/164 (55.49%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+ L++S N F+GEIP + N L+ L +++NS +G+IP + CGSL + F GNSL+G IP + FSG P + V+L +L L+L N L+G P + + +L EL L GNRFSG +PV + +LS L+LS N F+G IP
Sbjct: 335 KNLDVSGNLFSGEIPPDIGNLK-RLEELKLANNSLTGEIPVE-IKQCGSLDVLDFEGNSLKGQIPEFLGYMKALKVLSLGRNSFSGYVP---SSMVNLQQLERLNLGENNLNGSFPVELMALTSLSELDLSGNRFSGAVPVSISNLSNLSFLNLSGNGFSGEIP 493

HSP 2
Score: 93.9745 bits (232), Expect = 5.98773e-20
Identity = 61/164 (37.20%), Postives = 80/164 (48.78%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E+L L+ N TGEIP + SL LD NS GQIP+ F +L+ +S NS G +P S+ +G FP ++LT L LDLS N SG +P IS + NL L L GN FSG +P +G L+ LDLS +G +P
Sbjct: 359 EELKLANNSLTGEIPVEIKQCG-SLDVLDFEGNSLKGQIPE-FLGYMKALKVLSLGRNSFSGYVPSSMVNLQQLERLNLGENNLNGSFPV---ELMALTSLSELDLSGNRFSGAVPVSISNLSNLSFLNLSGNGFSGEIPASVGNLFKLTALDLSKQNMSGEVP 517

HSP 3
Score: 92.0485 bits (227), Expect = 2.27534e-19
Identity = 58/164 (35.37%), Postives = 80/164 (48.78%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E+LNL N G P L T SL LD+S N FSG +P + +L F++ +GN G IP S+ SG+ P +G L ++V+ L N SG +P+G S + +L+ + L N FSG +P G L L LSDN +GSIP
Sbjct: 431 ERLNLGENNLNGSFPVELMALT-SLSELDLSGNRFSGAVPVSI-SNLSNLSFLNLSGNGFSGEIPASVGNLFKLTALDLSKQNMSGEVPVELSG---LPNVQVIALQGNNFSGVVPEGFSSLVSLRYVNLSSNSFSGEIPQTFGFLRLLVSLSLSDNHISGSIP 589

HSP 4
Score: 87.0409 bits (214), Expect = 7.31951e-18
Identity = 62/163 (38.04%), Postives = 82/163 (50.31%), Query Frame = 2
Query:   14 LSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFV---SFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L N F+G +P ++ SL+++++SSNSFSG+IP F G LR + S + N + GSIP I R G P + L RL+VLDL N LSG IP IS +L L L N SG +P +L+K+DLS N TG IP
Sbjct: 531 LQGNNFSGVVPEGF-SSLVSLRYVNLSSNSFSGEIPQTF----GFLRLLVSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLMGHIPADLS---RLPRLKVLDLGQNNLSGEIPPEISQSSSLNSLSLDHNHLSGVIPGSFSGLSNLTKMDLSVNNLTGEIP 685

HSP 5
Score: 83.9593 bits (206), Expect = 6.19633e-17
Identity = 54/162 (33.33%), Postives = 84/162 (51.85%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+L RN F+G +P+S+ N L+ L++ N+ +G P + SL + +GN G++P SI+ FSG+ P +L +L LDLS +SG +P +S + N++ + LQGN FSG +P G L ++LS N F+G IP
Sbjct: 409 LSLGRNSFSGYVPSSMVNLQ-QLERLNLGENNLNGSFPVELM-ALTSLSELDLSGNRFSGAVPVSISNLSNLSFLNLSGNGFSGEIPASVG---NLFKLTALDLSKQNMSGEVPVELSGLPNVQVIALQGNNFSGVVPEGFSSLVSLRYVNLSSNSFSGEIP 565

HSP 6
Score: 83.1889 bits (204), Expect = 1.05693e-16
Identity = 56/164 (34.15%), Postives = 78/164 (47.56%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E N++ N +GEIP LP+ SL+FLD+SSN+FSGQIP G + L+ ++ + N L G IP S+ +L L+ L L N L G +P IS +L L N G +P G P L L LS+N F+G++P
Sbjct: 143 EVFNVAGNRLSGEIPVGLPS---SLQFLDISSNTFSGQIPSG-LANLTQLQLLNLSYNQLTGEIPASLG---------------------------NLQSLQYLWLDFNLLQGTLPSAISNCSSLVHLSASENEIGGVIPAAYGALPKLEVLSLSNNNFSGTVP 275

HSP 7
Score: 81.6481 bits (200), Expect = 3.07521e-16
Identity = 62/185 (33.51%), Postives = 85/185 (45.95%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPD--FANGYVSL---------------------TRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
LNLS N TGEIP SL N SL++L + N G +P +C SL +S + N + G IP + FSG P F N +++ T L+VLDL N +SG P ++ I +LK L + GN FSG +P +G L +L L++N TG IP
Sbjct: 191 LNLSYNQLTGEIPASLGNLQ-SLQYLWLDFNLLQGTLPSAI-SNCSSLVHLSASENEIGGVIPAAYGALPKLEVLSLSNNNFSGTVPFSLFCNTSLTIVQLGFNAFSDIVRPETTANCRTGLQVLDLQENRISGRFPLWLTNILSLKNLDVSGNLFSGEIPPDIGNLKRLEELKLANNSLTGEIP 373

HSP 8
Score: 80.8777 bits (198), Expect = 5.24551e-16
Identity = 58/163 (35.58%), Postives = 79/163 (48.47%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
KL+L N F G IPTSL T L + NS SG++P + SL + AGN L G IP + FSG P +G +LT+L++L+LS+N L+G IP + + +L+ L L N G LP + C L L S+N G IP
Sbjct: 96 KLSLRSNSFNGTIPTSLAYCTRLLSVF-LQYNSLSGKLPPA-MRNLTSLEVFNVAGNRLSGEIP--VGLPSSLQFLDISSNTFSGQIP---SGLANLTQLQLLNLSYNQLTGEIPASLGNLQSLQYLWLDFNLLQGTLPSAISNCSSLVHLSASENEIGGVIP 251

HSP 9
Score: 69.3218 bits (168), Expect = 1.57938e-12
Identity = 57/188 (30.32%), Postives = 78/188 (41.49%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXX--RFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
L+ S N G IP + A L+ L +S+N+FSG +P F + SL V N+ + T R SG FP + +SL L D+S N SG IP I + L+ELKL N +G +PV + C L LD N G IP+ F+G +P
Sbjct: 239 LSASENEIGGVIPAAY-GALPKLEVLSLSNNNFSGTVPFSLFCNT-SLTIVQLGFNAFSDIVRPETTANCRTGLQVLDLQENRISGRFPLWLTNILSLKNL---DVSGNLFSGEIPPDIGNLKRLEELKLANNSLTGEIPVEIKQCGSLDVLDFEGNSLKGQIPEFLGYMKALKVLSLGRNSFSGYVP 421

AT5G06940.1 5.99e-2034.15%
Leucine-rich repeat receptor-like prote...
HSP 1
Score: 93.9745 bits (232), Expect = 5.98773e-20
Identity = 56/164 (34.15%), Postives = 84/164 (51.22%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFA--GNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L+LS N +GEIP SL + +L LDVS N SG P G C R ++ + N +GS+P SI FSG+FP L R++++ +N +G +P+ +SL L+++++ N FSG +P G+GL L K S N F+G +P
Sbjct: 249 LDLSLNNLSGEIPRSLGPSLKNLVSLDVSQNKLSGSFPSGI---CSGKRLINLSLHSNFFEGSLPNSIGECLSLERLQVQNNGFSGEFPVVL---WKLPRIKIIRADNNRFTGQVPESVSLASALEQVEIVNNSFSGEIPHGLGLVKSLYKFSASQNRFSGELP 406

HSP 2
Score: 83.1889 bits (204), Expect = 1.05693e-16
Identity = 56/165 (33.94%), Postives = 80/165 (48.48%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP-DFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E+L + NGF+GE P L +K + +N F+GQ+P+ +L V NS G IP + RFSG+ P +F + V L ++++SHN L G IP+ + L L L GN F+G +P + L+ LDLSDN TG IP
Sbjct: 320 ERLQVQNNGFSGEFPVVLWKLP-RIKIIRADNNRFTGQVPESV-SLASALEQVEIVNNSFSGEIPHGLGLVKSLYKFSASQNRFSGELPPNFCDSPV----LSIVNISHNRLLGKIPE-LKNCKKLVSLSLAGNAFTGEIPPSLADLHVLTYLDLSDNSLTGLIP 477

HSP 3
Score: 80.1073 bits (196), Expect = 8.94749e-16
Identity = 58/188 (30.85%), Postives = 82/188 (43.62%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E+L L R+GF GEIPTS T SL+ LD+S N+ SG+IP S +L + + N L GS P +G S RL L L N G +P I +L+ L++Q N FSG PV + P + + +N FTG +P+ F+G++P
Sbjct: 223 EQLLLHRSGFHGEIPTSFVGLT-SLRTLDLSLNNLSGEIPRSLGPSLKNLVSLDVSQNKLSGSFP---------------------------SGICSGKRLINLSLHSNFFEGSLPNSIGECLSLERLQVQNNGFSGEFPVVLWKLPRIKIIRADNNRFTGQVPESVSLASALEQVEIVNNSFSGEIP 382

HSP 4
Score: 57.3806 bits (137), Expect = 6.21072e-09
Identity = 45/140 (32.14%), Postives = 64/140 (45.71%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLP 421
E++ + N F+GEIP L KF S N FSG++P F +S L V+ + N L G IP + F+G+ P L L LDLS N+L+G IP+G+ + L + N SG +P
Sbjct: 368 EQVEIVNNSFSGEIPHGLGLVKSLYKF-SASQNRFSGELPPNFCDS-PVLSIVNISHNRLLGKIPE-LKNCKKLVSLSLAGNAFTGEIPP---SLADLHVLTYLDLSDNSLTGLIPQGLQNL-KLALFNVSFNGLSGEVP 500

HSP 5
Score: 56.9954 bits (136), Expect = 8.11145e-09
Identity = 50/190 (26.32%), Postives = 78/190 (41.05%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFL---DVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLF-TGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+NL +GEI S+ C L +L D+S N F+ IP C +L ++ + N + G+IP I+ + L+V+D S N + G IP+ + L+ NL+ L L N +G +P +G L LDLS+N + IP F G++P
Sbjct: 80 INLQSLNLSGEISDSI----CDLPYLTHLDLSLNFFNQPIPLQL-SRCVTLETLNLSSNLIWGTIPDQIS---------------------------EFSSLKVIDFSSNHVEGMIPEDLGLLFNLQVLNLGSNLLTGIVPPAIGKLSELVVLDLSENSYLVSEIPSFLGKLDKLEQLLLHRSGFHGEIP 237

AT4G28490.1 7.82e-2037.30%
Leucine-rich receptor-like protein kina...
HSP 1
Score: 93.5893 bits (231), Expect = 7.82022e-20
Identity = 69/185 (37.30%), Postives = 88/185 (47.57%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP-----------------DFAN----GYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E L L N F+GEI +L SL + +S+N SGQIP GF+ L + + NS GSIP++I RFSG P DF+ V L +L LDLS N LSG IP+ + NL EL L N SG +P +G+ P L+ LDLS N F+G IP
Sbjct: 382 EYLILIDNSFSGEISNNLGKCK-SLTRVRLSNNKLSGQIPHGFW-GLPRLSLLELSDNSFTGSIPKTIIGAKNLSNLRISKNRFSGSIPNEIGSLNGIIEISGAENDFSGEIPESLVKLKQLSRLDLSKNQLSGEIPRELRGWKNLNELNLANNHLSGEIPKEVGILPVLNYLDLSSNQFSGEIP 564

HSP 2
Score: 87.0409 bits (214), Expect = 7.31951e-18
Identity = 64/209 (30.62%), Postives = 91/209 (43.54%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANG-----YVSLT----------------RLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E++ L N F+GE+P S+ N T +LK D S N +G+IPD + +L ++ N L+G +P SIT R +G P YV L+ +L L L N+ SG I + +L ++L N+ SG +P G P LS L+LSDN FTGSIP F+G +P
Sbjct: 263 EQIELFNNSFSGELPESMGNMT-TLKRFDASMNKLTGKIPDNL--NLLNLESLNLFENMLEGPLPESITRSKTLSELKLFNNRLTGVLPSQLGANSPLQYVDLSYNRFSGEIPANVCGEGKLEYLILIDNSFSGEISNNLGKCKSLTRVRLSNNKLSGQIPHGFWGLPRLSLLELSDNSFTGSIPKTIIGAKNLSNLRISKNRFSGSIP 468

HSP 3
Score: 86.6557 bits (213), Expect = 9.55957e-18
Identity = 56/187 (29.95%), Postives = 90/187 (48.13%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
+L L N TG +P+ L A L+++D+S N FSG+IP G L ++ NS G I ++ + SG P +G+ L RL +L+LS N+ +G IPK I NL L++ NRFSG++P +G + ++ ++N F+G IP+ +G++P
Sbjct: 335 ELKLFNNRLTGVLPSQL-GANSPLQYVDLSYNRFSGEIPANVCGE-GKLEYLILIDNSFSGEISNNLGKCKSLTRVRLSNNKLSGQIP---HGFWGLPRLSLLELSDNSFTGSIPKTIIGAKNLSNLRISKNRFSGSIPNEIGSLNGIIEISGAENDFSGEIPESLVKLKQLSRLDLSKNQLSGEIP 516

HSP 4
Score: 85.1149 bits (209), Expect = 2.78141e-17
Identity = 63/185 (34.05%), Postives = 87/185 (47.03%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFS--------GDFPDFANGYVS--------------LTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
L+LS N G IP SLP +LKFL++S N+ S IP F E L ++ AGN L G+IP S+ FS G+ + +++ LT L LDL+ N L+G IP I+ + +++++L N FSG LP MG L + D S N TG IPD
Sbjct: 119 LDLSENLLVGSIPKSLPFNLPNLKFLEISGNNLSDTIPSSFGEF-RKLESLNLAGNFLSGTIPASLGNVTTLKELKLAYNLFSPSQIPSQLGNLTELQVLWLAGCNLVGPIPPSLSRLTSLVNLDLTFNQLTGSIPSWITQLKTVEQIELFNNSFSGELPESMGNMTTLKRFDASMNKLTGKIPD 302

HSP 5
Score: 79.337 bits (194), Expect = 1.52621e-15
Identity = 57/162 (35.19%), Postives = 82/162 (50.62%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L LS N FTG IP ++ A +L L +S N FSG IP+ G + +S A N G IP S+ + SG+ P G+ +L L +L++N LSG IPK + ++ L L L N+FSG +P+ + L+ L+LS N +G IP
Sbjct: 432 LELSDNSFTGSIPKTIIGAK-NLSNLRISKNRFSGSIPNEIGSLNGIIE-ISGAENDFSGEIPESLVKLKQLSRLDLSKNQLSGEIPRELRGWKNLNEL---NLANNHLSGEIPKEVGILPVLNYLDLSSNQFSGEIPLELQNL-KLNVLNLSYNHLSGKIP 587

HSP 6
Score: 72.4034 bits (176), Expect = 1.86566e-13
Identity = 52/153 (33.99%), Postives = 71/153 (46.41%), Query Frame = 2
Query:   35 GEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
G IP SL T SL LD++ N +G IP + ++ + NS G +P S+ + +G PD N L L L+L N L G +P+ I+ L ELKL NR +G LP +G L +DLS N F+G IP
Sbjct: 226 GPIPPSLSRLT-SLVNLDLTFNQLTGSIPS-WITQLKTVEQIELFNNSFSGELPESMGNMTTLKRFDASMNKLTGKIPDNLN----LLNLESLNLFENMLEGPLPESITRSKTLSELKLFNNRLTGVLPSQLGANSPLQYVDLSYNRFSGEIP 372

AT5G44700.1 1.02e-1932.45%
Leucine-rich repeat transmembrane prote...
HSP 1
Score: 93.2041 bits (230), Expect = 1.02135e-19
Identity = 61/188 (32.45%), Postives = 92/188 (48.94%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFE-----------------------SCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFP-DFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++L LS +GEIP + N SLK LD+S+N+ +GQIPD F+ + +L+ + N+L+G +P+ I RFSG+ P + N TRL+ +D N LSG IP I + +L L L+ N GN+P +G C ++ +DL+DN +GSIP
Sbjct: 340 KQLFLSETQLSGEIPAEISNCQ-SLKLLDLSNNTLTGQIPDSLFQLVELTNLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGEMPVEIGN----CTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGNCHQMTVIDLADNQLSGSIP 522

HSP 2
Score: 85.1149 bits (209), Expect = 2.78141e-17
Identity = 53/164 (32.32%), Postives = 81/164 (49.39%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E L L++N +G +P ++ + SLK L +S SG+IP +C SL+ + + N+L G IP S+ G ++ +LT L+ L HN L G +PK I + L+ + L NRFSG +PV +G C L ++D N +G IP
Sbjct: 315 EFLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIP-AEISNCQSLKLLDLSNNTLTGQIPDSLFQLVELTNLYLNNNSLEG---TLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGEMPVEIGNCTRLQEIDWYGNRLSGEIP 474

HSP 3
Score: 79.7221 bits (195), Expect = 1.16858e-15
Identity = 54/166 (32.53%), Postives = 78/166 (46.99%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSF--AGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
E + N G +P SL N +L ++ SSN F+G I CGS ++SF N +G IP + +F+G P + ++ L +LD+S N+LSG IP + L L + L N SG +P +G P L +L LS N F GS+P
Sbjct: 532 ELFMIYNNSLQGNLPDSLINLK-NLTRINFSSNKFNGSISP----LCGSSSYLSFDVTENGFEGDIPLELGKSTNLDRLRLGKNQFTGRIP---RTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHIDLNNNYLSGVIPTWLGKLPLLGELKLSSNKFVGSLP 689

HSP 4
Score: 78.5666 bits (192), Expect = 2.60332e-15
Identity = 54/159 (33.96%), Postives = 81/159 (50.94%), Query Frame = 2
Query:   23 NGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGI-SLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
N G +P L N +L+ L++ NSFSG+IP + S+++++ GN LQG IP+ +T +G + + + +L L L+ N LSG +PK I S +LK+L L + SG +P + C L LDLS+N TG IPD
Sbjct: 226 NRLNGSLPAEL-NRLKNLQTLNLGDNSFSGEIPSQLGDLV-SIQYLNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVIHE---EFWRMNQLEFLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIPAEISNCQSLKLLDLSNNTLTGQIPD 379

HSP 5
Score: 78.5666 bits (192), Expect = 2.60332e-15
Identity = 57/164 (34.76%), Postives = 75/164 (45.73%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++L L +N FTG IP + + L LD+S NS SG IP C L + N L G IP + +F G P SLT + L L N+L+G IP+ I + L L L+ N+ SG LP +G L +L LS N TG IP
Sbjct: 603 DRLRLGKNQFTGRIPRTFGKIS-ELSLLDISRNSLSGIIPVEL-GLCKKLTHIDLNNNYLSGVIPTWLGKLPLLGELKLSSNKFVGSLP---TEIFSLTNILTLFLDGNSLNGSIPQEIGNLQALNALNLEENQLSGPLPSTIGKLSKLFELRLSRNALTGEIP 761

HSP 6
Score: 75.485 bits (184), Expect = 2.20384e-14
Identity = 57/163 (34.97%), Postives = 78/163 (47.85%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKE-LKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++L+ N +G IPT L L L +SSN F G +P F S ++ + GNSL GSIP+ I + SG P L++L L LS NAL+G IP I + +L+ L L N F+G +P + P L LDLS N G +P
Sbjct: 653 IDLNNNYLSGVIPTWLGKLPL-LGELKLSSNKFVGSLPTEIF-SLTNILTLFLDGNSLNGSIPQEIGNLQALNALNLEENQLSGPLPSTIG---KLSKLFELRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLPKLESLDLSHNQLVGEVP 810

HSP 7
Score: 75.0998 bits (183), Expect = 2.87831e-14
Identity = 53/162 (32.72%), Postives = 76/162 (46.91%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
++LS N G IPT+L N + SL+ L + SN SG IP S +L+ + N L G+IP + R +G P + + L +L+ L L N L G IP I +L NR +G+LP + +L L+L DN F+G IP
Sbjct: 100 IDLSSNRLVGPIPTTLSNLSSSLESLHLFSNLLSGDIPSQL-GSLVNLKSLKLGDNELNGTIPETFGNLVNLQMLALASCRLTGLIP---SRFGRLVQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAELNRLKNLQTLNLGDNSFSGEIP 257

HSP 8
Score: 64.6994 bits (156), Expect = 3.89015e-11
Identity = 45/163 (27.61%), Postives = 72/163 (44.17%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSI 490
++ L N G++P + L+ + + N FSG++P +C L+ + + GN L G IP SI G+ P +T V+DL+ N LSG IP + L+ + N GNLP + +L++++ S N F GSI
Sbjct: 412 QEFTLYHNNLEGKVPKEI-GFLGKLEIMYLYENRFSGEMPVEI-GNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGNCHQMT---VIDLADNQLSGSIPSSFGFLTALELFMIYNNSLQGNLPDSLINLKNLTRINFSSNKFNGSI 569

HSP 9
Score: 62.003 bits (149), Expect = 2.52152e-10
Identity = 55/211 (26.07%), Postives = 82/211 (38.86%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGF-----------------------FESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
E L+L N +G+IP+ L + +LK L + N +G IP+ F F L+ + N L+G IP I R +G P N L L+ L+L N+ SG IP + + +++ L L GN+ G +P + +L LDLS N TG I + +G LP
Sbjct: 123 ESLHLFSNLLSGDIPSQL-GSLVNLKSLKLGDNELNGTIPETFGNLVNLQMLALASCRLTGLIPSRFGRLVQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAELN---RLKNLQTLNLGDNSFSGEIPSQLGDLVSIQYLNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVIHEEFWRMNQLEFLVLAKNRLSGSLP 329

AT1G75640.1 1.33e-1938.04%
Leucine-rich receptor-like protein kina...
HSP 1
Score: 92.8189 bits (229), Expect = 1.33393e-19
Identity = 62/163 (38.04%), Postives = 80/163 (49.08%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
LN+S G TG IP S+ + L+ LD+S SGQ+P F L+ V+ N L G +P + FSG P Y L L+VL LSHN +SG IP I +L+ L+L N G++PV + L KLDLS N TGSIPD
Sbjct: 487 LNISGCGLTGRIPVSI-SGLMKLQVLDISKQRISGQLPVELF-GLPDLQVVALGNNLLGGVVPEGFSSLVSLKYLNLSSNLFSGHIP---KNYGFLKSLQVLSLSHNRISGTIPPEIGNCSSLEVLELGSNSLKGHIPVYVSKLSLLKKLDLSHNSLTGSIPD 644

HSP 2
Score: 84.7297 bits (208), Expect = 3.63263e-17
Identity = 67/212 (31.60%), Postives = 93/212 (43.87%), Query Frame = 2
Query:    2 EKLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVS-----FAG-------------------NSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
++L ++ N GEIPTS+ N SL+ +D N FSGQIP GF SL +S F+G N L G+IP IT RFSG+ P SL+ VL++S L+G IP IS + L+ L + R SG LPV + P L + L +NL G +P+ +F+G +P
Sbjct: 365 QELRVANNSLVGEIPTSIRNCK-SLRVVDFEGNKFSGQIP-GFLSQLRSLTTISLGRNGFSGRIPSDLLSLYGLETLNLNENHLTGAIPSEITKLANLTILNLSFNRFSGEVPSNVGDLKSLS---VLNISGCGLTGRIPVSISGLMKLQVLDISKQRISGQLPVELFGLPDLQVVALGNNLLGGVVPEGFSSLVSLKYLNLSSNLFSGHIP 571

HSP 3
Score: 82.8037 bits (203), Expect = 1.3804e-16
Identity = 57/162 (35.19%), Postives = 82/162 (50.62%), Query Frame = 2
Query:   14 LSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPD--GFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L N G +P ++ SLK+L++SSN FSG IP GF +S L+ +S + N + G+IP I G P + + L+ L+ LDLSHN+L+G IP IS +L+ L L N SG +P + +L+ LDLS N +IP
Sbjct: 537 LGNNLLGGVVPEGF-SSLVSLKYLNLSSNLFSGHIPKNYGFLKS---LQVLSLSHNRISGTIPPEIGNCSSLEVLELGSNSLKGHIPVYVS---KLSLLKKLDLSHNSLTGSIPDQISKDSSLESLLLNSNSLSGRIPESLSRLTNLTALDLSSNRLNSTIP 691

HSP 4
Score: 76.2554 bits (186), Expect = 1.29201e-14
Identity = 55/163 (33.74%), Postives = 77/163 (47.24%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPD 496
LNLS N F+G IP + SL+ L +S N SG IP +C SL + NSL+G IP ++ +G PD + SL L L+ N+LSG IP+ +S + NL L L NR + +P + L+ +LS N G IP+
Sbjct: 559 LNLSSNLFSGHIPKNY-GFLKSLQVLSLSHNRISGTIPPEI-GNCSSLEVLELGSNSLKGHIPVYVSKLSLLKKLDLSHNSLTGSIPDQISKDSSLESLL---LNSNSLSGRIPESLSRLTNLTALDLSSNRLNSTIPSSLSRLRFLNYFNLSRNSLEGEIPE 716

HSP 5
Score: 75.485 bits (184), Expect = 2.20384e-14
Identity = 49/162 (30.25%), Postives = 76/162 (46.91%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
L L N F+G+ P + N +L+ L+ + NS +G + D SLR+V + N++ G IP + + FSG+ P L L L L N L G IP ++ +L + GN +G +PV +G L + LS+N FTG++P
Sbjct: 121 LYLHYNSFSGDFPPEILNLR-NLQVLNAAHNSLTGNLSDVTVSK--SLRYVDLSSNAISGKIPANFSADSSLQLINLSFNHFSGEIPATLG---QLQDLEYLWLDSNQLQGTIPSALANCSSLIHFSVTGNHLTGLIPVTLGTIRSLQVISLSENSFTGTVP 276

HSP 6
Score: 64.6994 bits (156), Expect = 3.89015e-11
Identity = 54/216 (25.00%), Postives = 81/216 (37.50%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSL---------------------------PNATC---SLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIPDXXXXXXXXXXXXXXXXMFTGDLP 565
++LS N FTG +P SL NA C +L+ LD+ N +G P + SL + +GN G + + G+ P SL RV+D N SG IP +S + +L + L N FSG +P + L L+L++N TG+IP F+G++P
Sbjct: 264 ISLSENSFTGTVPVSLLCGYSGYNSSMRIIQLGVNNFTGIAKPSNAACVNPNLEILDIHENRINGDFP-AWLTDLTSLVVLDISGNGFSGGVTAKVGNLMALQELRVANNSLVGEIPTSIRNCKSL---RVVDFEGNKFSGQIPGFLSQLRSLTTISLGRNGFSGRIPSDLLSLYGLETLNLNENHLTGAIPSEITKLANLTILNLSFNRFSGEVP 475

HSP 7
Score: 63.5438 bits (153), Expect = 8.66635e-11
Identity = 50/164 (30.49%), Postives = 72/164 (43.90%), Query Frame = 2
Query:    5 KLNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTR-LRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGMGLCPHLSKLDLSDNLFTGSIP 493
+L L R TG + L T L+ L + +N +G +P C LR + NS G P I +G+ D V++++ LR +DLS NA+SG IP S +L+ + L N FSG +P +G L L L N G+IP
Sbjct: 72 ELRLPRLHLTGHLSPRLGELT-QLRKLSLHTNDINGAVPSSL-SRCVFLRALYLHYNSFSGDFPPEILNLRNLQVLNAAHNSLTGNLSD-----VTVSKSLRYVDLSSNAISGKIPANFSADSSLQLINLSFNHFSGEIPATLGQLQDLEYLWLDSNQLQGTIP 228

HSP 8
Score: 62.7734 bits (151), Expect = 1.47825e-10
Identity = 47/164 (28.66%), Postives = 75/164 (45.73%), Query Frame = 2
Query:    8 LNLSRNGFTGEIPTSLPNATCSLKFLDVSSNSFSGQIPDGFFESCGSLRFVSFAGNSLQGSIPRSITXXXXXXXXXXXXXRFSGDFPDFANGYVSLTRLRVLDLSHNALSGFIPKGISLIHNLKELKLQGNRFSGNLPVGM-----GLCPHLSKLDLSDNLFTG 484
LN + N TG + S + SL+++D+SSN+ SG+IP F + SL+ ++ + N G IP ++ + G P SL V + N L+G IP + I +L+ + L N F+G +PV + G + + L N FTG
Sbjct: 145 LNAAHNSLTGNL--SDVTVSKSLRYVDLSSNAISGKIPANF-SADSSLQLINLSFNHFSGEIPATLGQLQDLEYLWLDSNQLQGTIPSALANCSSLIHFSV---TGNHLTGLIPVTLGTIRSLQVISLSENSFTGTVPVSLLCGYSGYNSSMRIIQLGVNNFTG 302

Related info for CF810502