CF810451

Information for CF810451

NameCF810451
AccessionID4
Length640 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014530 cDNA cold acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CF810451
Sequence
GTCAAATGTGCCCTAAGGATGGAGAGAGAAGAATCAGATTTTAGGACTAGGCGTCAAGGA
AGTGGTTCAGGAGGACCTATCAGGACTGTGCAGAACGGCAACGATCGTGGGCCCTACCCA
GCCAGACCTAACCAAGTTAACCCCCAGCCTTGGAAGGGGAATGAAGTCAGGCAAGGACCG
CCGCCACAAAATTCTAACCATAACAACCAACTAGTCAAGTGTTACAACTGTGCGGGCTAT
GGACACTACAGTCGCAACTGTCCTCATCCGAGGAAGGACGGTTTCACCTATGGGAATCAG
CAGCAGCAGCAGCCGCAGCCGCTTCAGAACTATGGCAAACAGCCTATGCAATAGAACGCT
AGGCCAGCACATCAGAATAACTGGAATGGAAAGCAGCAGGTCAAGGTACCTCAGAACGGG
ACAGGACGCTTGTATGCTCTGCATGCTGAGGATCACATCCAGGAGCAGAAACCTTCTGTG
ACTCAAGGTACGCTACTGTTATTCAGTACCTGCGTACAAGCATTATTTGACACTGGAGCA
TCGCATTCGTTTATATCAGTTGCATGCGTATCTACGCTAGGATTAGACACTGAACCCCTA
GAGAACCAGATGACAATAGCATCACCTTTAAGCGCTAGNT
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0006508 biological_process proteolysis
GO:0004190 molecular_function aspartic-type endopeptidase activity
GO:0003676 molecular_function nucleic acid binding
GO:0008270 molecular_function zinc ion binding

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CF810451_1_ORF1 CRC64: 78234CA520705D1B LENGTH: 117 aa
InterPro
IPR001878
Domain
Zinc finger, CCHC-type
PF00098 [73-89]T 1.8e-05 PF00098 zf-CCHC zf-CCHC
SM00343 [73-89]T 0.0083 SM00343 no description no description
PS50158 [73-88]T 9.900 PS50158 ZF_CCHC ZF_CCHC
InterPro
IPR013084
Domain
Zinc finger, CCHC retroviral-type
G3DSA:4.10.60.10 [65-94]T 1.2e-06 G3DSA:4.10.60.10 no description no description
noIPR
unintegrated
unintegrated
seg [100-109]? NA seg seg seg
SSF57756 [66-94]T 4.5e-06 SSF57756 Retrovirus zinc finger-like domains Retrovirus zinc finger-like domains
SEQUENCE: CF810451_1_ORF2 CRC64: 6BE279C9E27FB60D LENGTH: 94 aa
InterPro
IPR001969
Active_site
Peptidase aspartic, active site
PS00141 [56-67]T NA PS00141 ASP_PROTEASE ASP_PROTEASE
InterPro
IPR013242
Domain
Retroviral aspartyl protease
PF08284 [27-91]T 1.7e-11 PF08284 RVP_2 RVP_2
SEQUENCE: CF810451_2_ORF3 CRC64: 3EB534FD1296CAC7 LENGTH: 88 aa
noIPR
unintegrated
unintegrated
seg [29-36]? NA seg seg seg
SEQUENCE: CF810451_3_ORF2 CRC64: D33EF1544EED1CD3 LENGTH: 52 aa
noIPR
unintegrated
unintegrated
seg [33-40]? NA seg seg seg
SEQUENCE: CF810451_4_ORF2 CRC64: 9839B17AC2D38CE7 LENGTH: 93 aa
noIPR
unintegrated
unintegrated
seg [56-65]? NA seg seg seg

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CF810451
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0298s002002.15e-0727.43%POPTR_0298s00200.1
HSP 1
Score: 52.7582 bits (125), Expect = 2.14881e-07
Identity = 48/175 (27.43%), Postives = 68/175 (38.86%), Query Frame = 1
Query:   64 GSGGPIRTVQNGNDRGPYPARPNQVNPQPWKGNEVRQGPPPQNSNHNNQLVKCYNCAGYGHYSRNCPHPRKDGFTYGNXXXXXXXXXXNYGKQPMQ*NARPAHQNNWNGKQQVKVPQNGT-GRLYALHAEDHIQEQKPSVTQGTLLLFSTCVQALFDTGASHSFISVACVSTLGL 585
GS G R V G G A P + +G++ R + C++C GH + CPH +G G +P+ RP K + + + T GR+Y + ED P V GTL L V AL D GASHSF++ +S L +
Sbjct: 182 GSSGGARHVNAGKHPGDCSATPGRCYICRGEGHQWRDCQYLERG--------CFHCGETGHKKKECPHKATEG-VQGQGITTQSQQQSVTVDRPV----RPTQSGTSANKSRPRFQEERTRGRIYHMTQED--VGAMPDVVAGTLQLGLIQVYALIDPGASHSFVAHRIISNLNV 341

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CF810451
Best 10 Hits Shown

Match Name E value Identity Description
ppa021406m 6.17e-0933.33%ppa021406m
HSP 1
Score: 57.3806 bits (137), Expect = 6.16978e-09
Identity = 30/90 (33.33%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  373 QNNWNGKQQVKVPQNGTGRLYALHA----EDHIQEQKPSVTQGTLLLFSTCVQALFDTGASHSFISVACVSTLGLDTEPLENQMTIASPL 630
++ + + K QN + LH D ++ +P+V +GT L+F+ + LFD GA++SFISV+ S LGL+ E +++ + + SPL
Sbjct: 159 RSRYQNPRSFKATQNSGFCYHCLHIGHYRRDLAKQNEPTVVEGTFLIFNLWARILFDPGATNSFISVSFASILGLEYEFMKSSLMVGSPL 248

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CF810451
Best 10 Hits Shown

Match Name E value Identity Description
Q53PJ3_ORYSJ5.00e-1235.00%
Retrotransposon protein, putative, Ty3-g...
HSP 1
Score: 75.0998 bits (183), Expect = 5.00185e-12
Identity = 63/180 (35.00%), Postives = 78/180 (43.33%), Query Frame = 1
Query:  112 PYPARPNQVNPQPWKGNEVRQGP---PPQNSNHNNQLVKCYNCAGYGHYSRNCPHPR--KDG-FTYGNXXXXXXXXXXNYGKQPMQ*NARPAHQNNWNGKQQVK--VPQNGTGRLYALHAEDHIQEQKPSVTQGTLLLFSTCVQALFDTGASHSFISVACVSTLGLDTEPLENQMTIASP 627
P P R V P+P + VRQ P N V CYNC GHYS +CP+P+ K G ++ G P Q P Q G V P G GRL + AE+ P V GT L+ S + LFD+GA+HSF+S L L TE L + M I SP
Sbjct: 292 PQPPRQMYVPPRP-QTQLVRQVPRAVQAAGDASRNANVTCYNCGKKGHYSPSCPYPKTGKSGPYSQG---------------APQQPRGPPQVQPGQRGAPAVPKPAPTFGRGRLNHVTAEE--ATDAPGVVLGTFLVHSIPLTVLFDSGATHSFMSTLKAKQLDLKTEFLSDAMRIQSP 453

Q7XUI0_ORYSJ8.53e-1228.50%
OSJNBa0020J04.2 protein OS=Oryza sativa ...
HSP 1
Score: 74.3294 bits (181), Expect = 8.53186e-12
Identity = 61/214 (28.50%), Postives = 80/214 (37.38%), Query Frame = 1
Query:   82 RTVQNGNDRGPYPARPNQVNPQP--------WKGNEVRQGPPPQNSNHNNQL-------------------VKCYNCAGYGHYSRNCPHPRKDGFTYGNXXXXXXXXXXNYGKQPMQ*NARPAHQNNWNGKQQVKVPQN-----GTGRLYALHAEDHIQEQKPSVTQGTLLLFSTCVQALFDTGASHSFISVACVSTLGLDTEPLENQMTIASP 627
RTV++ R +R Q+ PQ WK V P SN N + V C+NC GYGHY+ NCPHPRK G ++ P G+ K PQ+ G GR H ++ + G + ST V+ LFD+GASHSFIS+ L L M + SP
Sbjct: 153 RTVEHNRKRRLAMSRLPQIVPQRLKGATSSGWKPPIVATNRPAAPSNFNRPVAIQNRTPTPTLAAPGAKMNVNCFNCGGYGHYANNCPHPRKTPVRTGT------------NAMTVRGTTTPV-----TGRGLFKTPQSNRTATGLGRGQVNHVRAEEAQEDQGILMGMFSINSTPVKVLFDSGASHSFISLKASQKHNLTLVGLRKPMIVHSP 349

Q2R193_ORYSJ7.22e-1128.97%
Retrotransposon protein, putative, Ty3-g...
HSP 1
Score: 71.2478 bits (173), Expect = 7.22265e-11
Identity = 62/214 (28.97%), Postives = 79/214 (36.92%), Query Frame = 1
Query:   82 RTVQNGNDRGPYPARPNQVNPQP--------WKGNEVRQGPPPQNSNHNNQL-------------------VKCYNCAGYGHYSRNCPHPRKDGFTYGNXXXXXXXXXXNYGKQPMQ*NARPAHQNNWNGKQQVKVPQN-----GTGRLYALHAEDHIQEQKPSVTQGTLLLFSTCVQALFDTGASHSFISVACVSTLGLDTEPLENQMTIASP 627
RTV++ R +RP Q PQ WK V P SN N + V C+NC YGHY+ NCPHPRK G ++ P G+ K PQ+ G GR H ++ V G + ST V+ LFD+GASHSFIS+ L L M + SP
Sbjct: 559 RTVEHNRKRRLAMSRPPQTVPQRLKGATPSGWKPPVVVTNRPAAPSNFNRPVALQNRTPTPTLAAPGAKKNVDCFNCGEYGHYANNCPHPRKTPVRTG------------ANAMTVRGTTTPT-----VGRGLFKTPQSNRTTTGFGRGQVNHVRAEEAQEDQGVLMGMFSINSTPVKVLFDSGASHSFISLKASQKHNLTLVGLRKPMIVHSP 755

Q7XX43_ORYSJ1.23e-1026.98%
OSJNBa0059D20.6 protein OS=Oryza sativa ...
HSP 1
Score: 70.4774 bits (171), Expect = 1.232e-10
Identity = 51/189 (26.98%), Postives = 65/189 (34.39%), Query Frame = 1
Query:  118 PARPNQVNPQPWKGNEVRQGPPPQNSNHNNQLV-------------------KCYNCAGYGHYSRNCPHPRKDGFTYGNXXXXXXXXXXNYGKQPMQ*NARPAHQNNWNGKQQVKVPQNGTGRLYALHAEDHIQEQKPSVTQGTLLLFSTCVQALFDTGASHSFISVACVSTLGLDTEPLENQMTIASP 627
P RP P W+ V P +SN + + C+NC YGH++ CPHP K G + A PA Q G GR H ++ V G L ST V+ LFD+GASHSFIS+ L L M + SP
Sbjct: 238 PQRPKGTTPSAWRPTVVTTSRPAASSNFHRPVTIQNRAPTPNQAATGSVRPGSCFNCGEYGHFANKCPHPNKTPIRTGA------------NATAIHGTATPAAGRGLFRTPQTNRTATGFGRGQVNHVRAEEAQEDQGVLMGMFSLNSTPVKVLFDSGASHSFISLKASQQHNLTRVKLRQPMLVHSP 414

Q6AV77_ORYSJ1.61e-1029.70%
Retrotransposon protein, putative, Ty3-g...
HSP 1
Score: 70.0922 bits (170), Expect = 1.60904e-10
Identity = 60/202 (29.70%), Postives = 83/202 (41.09%), Query Frame = 1
Query:   22 EREESDFRTRRQGSGSGGPIRTVQNGNDRGPYPARPNQVNPQPWKGNEVRQGPPPQNSNHNNQLVKCYNCAGYGHYSRNCPHPRKDGFTYGNXXXXXXXXXXNYGKQPMQ*NARPAHQNNWNGKQQVKVPQNGTGRLYALHAEDHIQEQKPSVTQGTLLLFSTCVQALFDTGASHSFISVACVSTLGLDTEPLENQMTIASP 627
+R ++FR ++ G R Q + +G RP QP +G QGP C+NC GH++ CP PR+ Q P NN GK ++ GR+ + AED + P V GT L++S LFD+GASHSFISV V + L E L N + I +P
Sbjct: 572 KRRLANFRNQQ-----GANQRPQQQQSQQGTRAPRPPTPAVQPSQGRRDAQGPQRL----------CFNCFEPGHFADKCPKPRR------------------------QQGQAPPRPNN-GGKDVIR------GRVNHVTAEDVLTT--PDVIVGTFLIYSIPATILFDSGASHSFISVPFVGRIQLGVERLRNPLLITTP 725

Q53QL2_ORYSJ1.61e-1028.71%
Retrotransposon protein, putative, Ty3-g...
HSP 1
Score: 70.0922 bits (170), Expect = 1.60904e-10
Identity = 60/209 (28.71%), Postives = 74/209 (35.41%), Query Frame = 1
Query:   82 RTVQNGNDRGPYPARPNQVNPQP--------WKGNEVRQGPPPQNSNHNNQLV-------------------KCYNCAGYGHYSRNCPHPRKDGFTYGNXXXXXXXXXXNYGKQPMQ*NARPAHQNNWNGKQQVKVPQNGTGRLYALHAEDHIQEQKPSVTQGTLLLFSTCVQALFDTGASHSFISVACVSTLGLDTEPLENQMTIASP 627
RTV++ + R RP Q PQ WK V P SN N +V C+NC YGHY+ NCPHPRK G ++ PA Q G GR H ++ V G + ST V+ LFD+GASHSFIS L L M + SP
Sbjct: 218 RTVEHNHKRRLAMNRPPQGVPQRLKGATSSGWKPPIVAPNRPAAPSNFNRPVVIQNRTPTPTLAAPGAKKNVDCFNCGEYGHYANNCPHPRKTPVRTG------------ANAMTVRGTTTPAAGRGLFKTPQTNRTATGFGRGQVNHVRAEEAQEDQGVLMGMFSINSTPVKVLFDSGASHSFISRKASQKHNLTLVGLRKPMIVHSP 414

Q2QR60_ORYSJ1.61e-1028.97%
Retrotransposon protein, putative, Ty3-g...
HSP 1
Score: 70.0922 bits (170), Expect = 1.60904e-10
Identity = 62/214 (28.97%), Postives = 78/214 (36.45%), Query Frame = 1
Query:   82 RTVQNGNDRGPYPARPNQVNPQPWKGNEVRQGPPPQN--------SNHNNQL-------------------VKCYNCAGYGHYSRNCPHPRKDGFTYGNXXXXXXXXXXNYGKQPMQ*NARPAHQNNWNGKQQVKVPQ-----NGTGRLYALHAEDHIQEQKPSVTQGTLLLFSTCVQALFDTGASHSFISVACVSTLGLDTEPLENQMTIASP 627
RTV++ R +RP Q PQ KG PP SN N + V C+NC YGHY+ NCPHPRK G ++ PA G+ K PQ G GR H ++ V G L ST ++ LFD+GA HSFIS+ L L M + SP
Sbjct: 218 RTVEHNRKRRLAMSRPPQTMPQRLKGATPSGWKPPVMVTNRPAALSNFNRPVALQNRTPTPTLAAPGAKKNVDCFNCGKYGHYANNCPHPRKTPVRTG------------ANAMTVRGTTTPA-----VGRGLFKTPQPNRTTTGFGRGQVNHVRAEEAQEDQGVLMGMFSLNSTPIKVLFDSGALHSFISLKASQQHNLTRVKLRQPMLVHSP 414

Q7XUA3_ORYSJ2.10e-1028.87%
OSJNBa0019D11.8 protein OS=Oryza sativa ...
HSP 1
Score: 69.707 bits (169), Expect = 2.10147e-10
Identity = 56/194 (28.87%), Postives = 71/194 (36.60%), Query Frame = 1
Query:  118 PARPNQVNPQPWKGNEVRQGPPPQNSNHNNQL-------------------VKCYNCAGYGHYSRNCPHPRKDGFTYGNXXXXXXXXXXNYGKQPMQ*NARPAHQNNWNGKQQVKVPQN-----GTGRLYALHAEDHIQEQKPSVTQGTLLLFSTCVQALFDTGASHSFISVACVSTLGLDTEPLENQMTIASP 627
P R P WK + P SN N + V C+NC YGHY+ NCPHPRK G ++ PA G+ K PQ+ G GR H ++ V G + ST V+ LFD+GASHSFIS+ L L M + SP
Sbjct: 238 PQRLKGATPSGWKPPVMVTNRPAALSNFNRPVALQNRTPTPTLAAPGAKKNVDCFNCGEYGHYANNCPHPRKTPIRTG------------ANAMTVRGTTTPA-----VGRGLFKTPQSNRTTTGFGRGQVNHVRAEEAQEDQGVLMGMFSINSTPVKVLFDSGASHSFISLKASQKHNLTLVGLRKPMIVHSP 414

Q2R1L3_ORYSJ2.10e-1028.97%
Retrotransposon protein, putative, Ty3-g...
HSP 1
Score: 69.707 bits (169), Expect = 2.10147e-10
Identity = 62/214 (28.97%), Postives = 79/214 (36.92%), Query Frame = 1
Query:   82 RTVQNGNDRGPYPARPNQVNPQPWKGNEVRQGPPPQN--------SNHNNQL-------------------VKCYNCAGYGHYSRNCPHPRKDGFTYGNXXXXXXXXXXNYGKQPMQ*NARPAHQNNWNGKQQVKVPQN-----GTGRLYALHAEDHIQEQKPSVTQGTLLLFSTCVQALFDTGASHSFISVACVSTLGLDTEPLENQMTIASP 627
RTV++ R + P Q PQ KG PP SN N + V C+NC YGHY+ NCPHPRK G ++ PA G+ K PQ+ G GR H ++ V G + ST V+ LFD+GASHSFIS+ L L M + SP
Sbjct: 596 RTVEHNRKRRLAMSHPPQTVPQRLKGAPPSGWKPPVMVTNRPAALSNFNRPVALQNRTPTPTLAAPGAKKNVDCFNCGEYGHYANNCPHPRKTPVRTG------------ANAMTVRGTTTPA-----IGRGLFKTPQSNRTATGFGRGQVNHVRAEEAQEDQGVLMGMFSINSTPVKVLFDSGASHSFISLKASQKHNLTLVGLRKPMIVHSP 792

Q01I31_ORYSA2.10e-1028.87%
OSIGBa0145G11.8 protein OS=Oryza sativa ...
HSP 1
Score: 69.707 bits (169), Expect = 2.10147e-10
Identity = 56/194 (28.87%), Postives = 71/194 (36.60%), Query Frame = 1
Query:  118 PARPNQVNPQPWKGNEVRQGPPPQNSNHNNQL-------------------VKCYNCAGYGHYSRNCPHPRKDGFTYGNXXXXXXXXXXNYGKQPMQ*NARPAHQNNWNGKQQVKVPQN-----GTGRLYALHAEDHIQEQKPSVTQGTLLLFSTCVQALFDTGASHSFISVACVSTLGLDTEPLENQMTIASP 627
P R P WK + P SN N + V C+NC YGHY+ NCPHPRK G ++ PA G+ K PQ+ G GR H ++ V G + ST V+ LFD+GASHSFIS+ L L M + SP
Sbjct: 238 PQRLKGATPSGWKPPVMVTNRPAALSNFNRPVALQNRTPTPTLAAPGAKKNVDCFNCGEYGHYANNCPHPRKTPIRTG------------ANAMTVRGTTTPA-----VGRGLFKTPQSNRTTTGFGRGQVNHVRAEEAQEDQGVLMGMFSINSTPVKVLFDSGASHSFISLKASQKHNLTLVGLRKPMIVHSP 414

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CF810451
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010187800015.70e-1142.47%GSVIVT01018780001 assembled CDS
HSP 1
Score: 63.929 bits (154), Expect = 5.70202e-11
Identity = 31/73 (42.47%), Postives = 49/73 (67.12%), Query Frame = 1
Query:  412 QNGTGRLYALHAEDHIQEQKPSVTQGTLLLFSTCVQALFDTGASHSFISVACVSTLGLDTEPLENQMTIASPL 630
+ GR++AL + E+ + +G +L++ST V+ LFDTGA+HSFIS +C + LGL +E +EN + I SP+
Sbjct: 397 RQAAGRVFALTPTE--PEEDALLVEGMILVYSTWVRVLFDTGATHSFISASCANALGLKSERVENLLLIESPM 467

Related info for CF810451