Vaccinium_corymbosum_v1_Contig678

Information for Vaccinium_corymbosum_v1_Contig678

NameVaccinium_corymbosum_v1_Contig678
AccessionID5352
Length574 bp
Typecontig
Organism highbush blueberry (Vaccinium corymbosum)
Sequence
GTTGTGGGTTTCGGAAATCGCTATCCTAAGCACGTCCATCATAGAGGTGCATCGATCCCC
AAAAACAAGGTCAAGTATAATTGTAAAGGAGGGTGGAAATGGAGGGACACATCAAAGCCA
AACCCAAACACCATTGTCGGAGCCATGGTTGCGGGCCCTGTACAAACACGACGGTTTCCA
CGACGTGCGTACTAACTACAATTACACGGAGCCCACCATTGCAGGAAATGCCGGTTTAGT
TGCTGCCCTTGTGGCTCTCTCAGGTGAAAAGAGTGTTGGGATTGACAAAAACACCATGTT
CTCTGCTGTTCCACCCATGTCTCCTACTCCACCACCACCTCCAGCGCCATGGAAACCATG
ATGTTGTTCGTAGATGATTTTGGCTTTATAGTTTTTGGAATCTGAACATTGTGAGAAGTG
AAAACAAAACAAAAAAATGTGATGGGGCATAAAAAACTGCAGGTGGCTGGGGATGGAAAC
TAGAGACTTGGACTACCTTGNACAAAGTGAGATTTCGATATTGAACTTGNTTTTGAATTT
TTTTTTNGTGATTATACATAGCATATGTATGTAC
Download sequence in fasta format

Comprising EST/subcontigs

Type Feature Position
EST CF811143 0-236
EST CF811627 0-574

GO terms assigned to this feature

Accession Category Term
GO:0005975 biological_process carbohydrate metabolic process
GO:0003824 molecular_function catalytic activity

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: Vaccinium_corymbosum_v1_Contig678_1_ORF1 CRC64: 0156C04009AEFB63 LENGTH: 64 aa
InterPro
IPR001701
Family
Glycoside hydrolase, family 9
PTHR22298:SF3 [1-60]T 4.4e-24 PTHR22298:SF3 ENDO-1,4-BETA-GLUCANASE ENDO-1,4-BETA-GLUCANASE
PF00759 [1-59]T 4e-13 PF00759 Glyco_hydro_9 Glyco_hydro_9
InterPro
IPR008928
Domain
Six-hairpin glycosidase-like
SSF48208 [1-58]T 3.3e-12 SSF48208 Six-hairpin glycosidases Six-hairpin glycosidases
InterPro
IPR012341
Domain
Six-hairpin glycosidase
G3DSA:1.50.10.10 [1-59]T 4e-17 G3DSA:1.50.10.10 no description no description
noIPR
unintegrated
unintegrated
PTHR22298 [1-60]T 4.4e-24 PTHR22298 ENDO-1,4-BETA-GLUCANASE ENDO-1,4-BETA-GLUCANASE
SEQUENCE: Vaccinium_corymbosum_v1_Contig678_2_ORF1 CRC64: F5BF20650C3165E0 LENGTH: 119 aa
InterPro
IPR001701
Family
Glycoside hydrolase, family 9
PTHR22298:SF3 [55-118]T 1.3e-20 PTHR22298:SF3 ENDO-1,4-BETA-GLUCANASE ENDO-1,4-BETA-GLUCANASE
InterPro
IPR008928
Domain
Six-hairpin glycosidase-like
SSF48208 [55-106]T 9.8e-07 SSF48208 Six-hairpin glycosidases Six-hairpin glycosidases
InterPro
IPR012341
Domain
Six-hairpin glycosidase
G3DSA:1.50.10.10 [34-87]T 2e-06 G3DSA:1.50.10.10 no description no description
InterPro
IPR018221
Active_site
Glycoside hydrolase, family 9, active site
PS00698 [59-77]T NA PS00698 GLYCOSYL_HYDROL_F9_2 GLYCOSYL_HYDROL_F9_2
noIPR
unintegrated
unintegrated
PTHR22298 [55-118]T 1.3e-20 PTHR22298 ENDO-1,4-BETA-GLUCANASE ENDO-1,4-BETA-GLUCANASE
seg [74-86]? NA seg seg[104-119]? NA seg seg seg
SEQUENCE: Vaccinium_corymbosum_v1_Contig678_3_ORF2 CRC64: 322021CB37FC0877 LENGTH: 50 aa
noIPR
unintegrated
unintegrated
seg [26-40]? NA seg seg seg
SEQUENCE: Vaccinium_corymbosum_v1_Contig678_4_ORF2 CRC64: EBA0D04ED2844CC5 LENGTH: 96 aa
noIPR
unintegrated
unintegrated
seg [44-61]? NA seg seg seg
SEQUENCE: Vaccinium_corymbosum_v1_Contig678_5_ORF2 CRC64: 398E86CE1F181D64 LENGTH: 54 aa
noIPR
unintegrated
unintegrated
seg [11-25]? NA seg seg seg

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: Vaccinium_corymbosum_v1_Contig678
Best 10 Hits Shown

Match Name E value Identity Description
ppa002911m 8.28e-4092.45%ppa002911m
HSP 1
Score: 115.161 bits (287), Expect = 8.28433e-40
Identity = 49/53 (92.45%), Postives = 51/53 (96.23%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVGFGNRYPKHVHHRGASIPKNK+KYNCKGGWKWRDTSK NPNT+ GAMVAGP
Sbjct: 504 VVGFGNRYPKHVHHRGASIPKNKIKYNCKGGWKWRDTSKANPNTLDGAMVAGP 556

HSP 2
Score: 65.855 bits (159), Expect = 8.28433e-40
Identity = 30/49 (61.22%), Postives = 35/49 (71.43%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
KHDGF DVR+NYNYTEPT+ SGEK++GIDKNT+FSAV
Sbjct: 558 KHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKNIGIDKNTIFSAV 606

ppa014845m 2.06e-3481.13%ppa014845m
HSP 1
Score: 101.293 bits (251), Expect = 2.06119e-34
Identity = 43/53 (81.13%), Postives = 46/53 (86.79%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVGFGN +PKHVHH GASIPK K+KY CK GWKWRD+ KPNP TIVGAMVAGP
Sbjct: 441 VVGFGNHFPKHVHHSGASIPKKKIKYTCKEGWKWRDSLKPNPYTIVGAMVAGP 493

HSP 2
Score: 61.6178 bits (148), Expect = 2.06119e-34
Identity = 29/50 (58.00%), Postives = 34/50 (68.00%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSV-GIDKNTMFSAV 310
KHDGFHDVR NYNYTEPT+ SG+++ GIDKNTMFSA+
Sbjct: 495 KHDGFHDVRANYNYTEPTLVGNAGLVAALVALSGDRTTDGIDKNTMFSAI 544

ppa026228m 6.49e-2073.58%ppa026228m
HSP 1
Score: 93.5893 bits (231), Expect = 6.49388e-20
Identity = 39/53 (73.58%), Postives = 45/53 (84.91%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVGF +P+HVHHRGASIP NK+KY CKGG KW+++ PNPNTIVGAMVAGP
Sbjct: 487 VVGFSEHFPQHVHHRGASIPHNKIKYGCKGGLKWKNSRTPNPNTIVGAMVAGP 539

HSP 2
Score: 52.7582 bits (125), Expect = 1.2703e-07
Identity = 30/80 (37.50%), Postives = 39/80 (48.75%), Query Frame = 2
Query:   83 VKEGGNGGTHQSQTQTPLSEPWLRALY----KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
+K G GG ++TP + A+ KHD F DVR NYNYTEP++ S GID+N+MF AV
Sbjct: 510 IKYGCKGGLKWKNSRTPNPNTIVGAMVAGPDKHDNFQDVRFNYNYTEPSLVGNAGLVAALVALSSGTPAGIDRNSMFYAV 589

ppa004387m 3.75e-1244.44%ppa004387m
HSP 1
Score: 65.0846 bits (157), Expect = 3.75265e-12
Identity = 28/63 (44.44%), Postives = 40/63 (63.49%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPK---NKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRFP 180
+VG+G RYP+ +HHRG+S+P + K C G+ + PNPN +VGA++ GP Q RFP
Sbjct: 418 MVGYGPRYPQRIHHRGSSLPSIAAHPAKIQCSSGFNVMRSQSPNPNILVGAVIGGPDQHDRFP 480

HSP 2
Score: 22.7126 bits (47), Expect = 3.75265e-12
Identity = 8/17 (47.06%), Postives = 12/17 (70.59%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEP 214
+HD F D R++Y +EP
Sbjct: 475 QHDRFPDQRSDYEQSEP 491

ppa004653m 1.38e-1144.64%ppa004653m
HSP 1
Score: 64.3142 bits (155), Expect = 1.3817e-11
Identity = 25/56 (44.64%), Postives = 41/56 (73.21%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIP---KNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
+VGFG +YP H+HHRG+S+P ++ + +C G+++ ++ PNPN +VGA+V GP
Sbjct: 402 MVGFGKKYPLHIHHRGSSLPSVHEHPERISCNNGFQYLNSGSPNPNVLVGAIVGGP 457

HSP 2
Score: 21.557 bits (44), Expect = 1.3817e-11
Identity = 8/15 (53.33%), Postives = 9/15 (60.00%), Query Frame = 2
Query:  170 DGFHDVRTNYNYTEP 214
D F D R NY +EP
Sbjct: 461 DSFSDDRNNYQQSEP 475

ppa022524m 1.78e-1149.21%ppa022524m
HSP 1
Score: 60.8474 bits (146), Expect = 1.78329e-11
Identity = 31/63 (49.21%), Postives = 39/63 (61.90%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYN---CKGGWK-WRDTSKPNPNTIVGAMVAGPVQTRRF 177
+VGFG++YP HVHHRGASIP V + C G++ W + NPN I GA+V GP Q F
Sbjct: 405 IVGFGSKYPVHVHHRGASIPDVSVLQSVVGCVQGFETWYHRPQANPNVIYGALVGGPDQNDNF 467

HSP 2
Score: 24.6386 bits (52), Expect = 1.78329e-11
Identity = 9/19 (47.37%), Postives = 14/19 (73.68%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTI 220
++D F D R++Y TEPT+
Sbjct: 463 QNDNFSDDRSSYEETEPTL 481

ppa005285m 3.23e-1154.39%ppa005285m
HSP 1
Score: 64.6994 bits (156), Expect = 3.23036e-11
Identity = 31/57 (54.39%), Postives = 40/57 (70.18%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKV---KYNCKGGW-KWRDTSKPNPNTIVGAMVAGP 159
+VGFG +YP H+HHRG+SIP KV K +C GG+ + + PNPNT VGA+V GP
Sbjct: 370 MVGFGAKYPTHLHHRGSSIPSMKVHPTKVDCDGGYSSYYSSPNPNPNTHVGAVVGGP 426

ppa004644m 2.09e-1044.44%ppa004644m
HSP 1
Score: 62.003 bits (149), Expect = 2.09386e-10
Identity = 28/63 (44.44%), Postives = 41/63 (65.08%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKV---KYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRFP 180
+VG+G RYP+ +HHRG+S+P +V CK G ++ + PNPN +VGA+V GP + FP
Sbjct: 406 MVGYGARYPQRIHHRGSSLPSVQVHPAHIGCKAGSRYFLSPNPNPNLLVGAVVGGPNSSDAFP 468

ppa004719m 4.06e-1042.19%ppa004719m
HSP 1
Score: 56.6102 bits (135), Expect = 4.06388e-10
Identity = 27/64 (42.19%), Postives = 41/64 (64.06%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIP---KNKVKYNCKGGWK-WRDTSKPNPNTIVGAMVAGPVQTRRFP 180
+VG+G +PK +HHRG+S+P + C GG++ + ++ PNPN +VGA+V GP Q FP
Sbjct: 399 MVGYGPYFPKRIHHRGSSLPSKASHPQNMGCDGGFQPFFYSANPNPNILVGAIVGGPNQNDGFP 462

HSP 2
Score: 24.2534 bits (51), Expect = 4.06388e-10
Identity = 8/17 (47.06%), Postives = 15/17 (88.24%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEP 214
++DGF D R++Y+++EP
Sbjct: 457 QNDGFPDDRSDYSHSEP 473

ppa021556m 5.28e-1049.12%ppa021556m
HSP 1
Score: 59.3066 bits (142), Expect = 5.2808e-10
Identity = 28/57 (49.12%), Postives = 37/57 (64.91%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGA---SIPKNKVKYNCKGGW-KWRDTSKPNPNTIVGAMVAGP 159
+VGFG +YP VHHR A SI K+ +CKGG+ W + + PNPN + GA+V GP
Sbjct: 373 MVGFGTKYPTQVHHRAASIVSIKKDAAPVSCKGGFDSWFNNNSPNPNVLDGAIVGGP 429

HSP 2
Score: 21.1718 bits (43), Expect = 5.2808e-10
Identity = 7/17 (41.18%), Postives = 11/17 (64.71%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEP 214
++D + D R+NY EP
Sbjct: 431 ENDAYTDSRSNYQMAEP 447

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: Vaccinium_corymbosum_v1_Contig678
Best 10 Hits Shown

Match Name E value Identity Description
GUN25_ARATH5.26e-3388.68%
Endoglucanase 25 OS=Arabidopsis thaliana...
HSP 1
Score: 112.079 bits (279), Expect = 5.26054e-33
Identity = 47/53 (88.68%), Postives = 50/53 (94.34%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVGFG +YP+HVHHRGASIPKNKVKYNCKGGWKWRD+ KPNPNTI GAMVAGP
Sbjct: 501 VVGFGTKYPRHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP 553

HSP 2
Score: 49.6766 bits (117), Expect = 5.26054e-33
Identity = 26/51 (50.98%), Postives = 30/51 (58.82%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSV--GIDKNTMFSAV 310
K DG+ DVR NYNYTEPT+ SGE+ IDKNT+FSAV
Sbjct: 555 KRDGYRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDKNTIFSAV 605

GUN21_ARATH5.41e-2969.81%
Endoglucanase 21 OS=Arabidopsis thaliana...
HSP 1
Score: 80.8777 bits (198), Expect = 5.41407e-29
Identity = 37/53 (69.81%), Postives = 42/53 (79.25%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVG+G RYPK VHHRGASIPKN +K C GG+KW+ + K NPN I GAMVAGP
Sbjct: 502 VVGYGQRYPKQVHHRGASIPKN-MKETCTGGFKWKKSKKNNPNAINGAMVAGP 553

HSP 2
Score: 67.3958 bits (163), Expect = 5.41407e-29
Identity = 33/50 (66.00%), Postives = 36/50 (72.00%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSV-GIDKNTMFSAV 310
KHDGFHD+RTNYNYTEPT+ SGEK+V GIDKNTMFSAV
Sbjct: 555 KHDGFHDIRTNYNYTEPTLAGNAGLVAALVALSGEKAVGGIDKNTMFSAV 604

GUN9_ORYSJ2.49e-2284.91%
Endoglucanase 9 OS=Oryza sativa subsp. j...
HSP 1
Score: 105.145 bits (261), Expect = 2.48903e-22
Identity = 45/53 (84.91%), Postives = 47/53 (88.68%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVG+GNRYPK VHHRGASIPKN V Y CKGGWKWR+T KPNPN IVGAMVAGP
Sbjct: 502 VVGYGNRYPKRVHHRGASIPKNGVHYGCKGGWKWRETKKPNPNIIVGAMVAGP 554

HSP 2
Score: 53.5286 bits (127), Expect = 8.59444e-07
Identity = 34/80 (42.50%), Postives = 41/80 (51.25%), Query Frame = 2
Query:   83 VKEGGNGGTHQSQTQTPLSEPWLRALY----KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
V G GG +T+ P + A+ +HDGF DVR NYNYTE T+ SGE G+DKNTMFSAV
Sbjct: 525 VHYGCKGGWKWRETKKPNPNIIVGAMVAGPDRHDGFKDVRKNYNYTEATLAGNAGLVAALVALSGE-GHGVDKNTMFSAV 603

GUN7_ARATH2.05e-2060.38%
Endoglucanase 7 OS=Arabidopsis thaliana ...
HSP 1
Score: 77.7962 bits (190), Expect = 2.04825e-20
Identity = 32/53 (60.38%), Postives = 41/53 (77.36%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVGFG ++P+ VHHRGA+IP +K + +C+ G K+RDT PNPN I GAMV GP
Sbjct: 505 VVGFGKKFPRRVHHRGATIPNDKKRRSCREGLKYRDTKNPNPNNITGAMVGGP 557

HSP 2
Score: 41.5874 bits (96), Expect = 2.04825e-20
Identity = 20/49 (40.82%), Postives = 26/49 (53.06%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
K D FHD+R NYN +EPT+ + IDKNTMF++V
Sbjct: 559 KFDEFHDLRNNYNASEPTLSGNAGLVAALVSLTSSGGQQIDKNTMFNSV 607

GUN10_ORYSJ5.19e-2075.47%
Endoglucanase 10 OS=Oryza sativa subsp. ...
HSP 1
Score: 97.4413 bits (241), Expect = 5.18994e-20
Identity = 40/53 (75.47%), Postives = 46/53 (86.79%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVGFGN+YPK HHRGASIP N VKY CKGG+KWR+T KPNPN ++GA+VAGP
Sbjct: 501 VVGFGNKYPKRAHHRGASIPHNGVKYGCKGGFKWRETKKPNPNILIGALVAGP 553

HSP 2
Score: 55.8398 bits (133), Expect = 1.73172e-07
Identity = 35/81 (43.21%), Postives = 42/81 (51.85%), Query Frame = 2
Query:   83 VKEGGNGGTHQSQTQTPLSEPWLRALY----KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSG-EKSVGIDKNTMFSAV 310
VK G GG +T+ P + AL +HDGF DVRTNYNYTEPT+ + GIDKNT+FSAV
Sbjct: 524 VKYGCKGGFKWRETKKPNPNILIGALVAGPDRHDGFKDVRTNYNYTEPTLAANAGLVAALISLTNIHVKSGIDKNTIFSAV 604

GUN12_ORYSJ1.68e-1957.63%
Endoglucanase 12 OS=Oryza sativa subsp. ...
HSP 1
Score: 84.7297 bits (208), Expect = 1.67572e-19
Identity = 34/59 (57.63%), Postives = 45/59 (76.27%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRF 177
VVG+G +YP+ +HHRGAS P N +KY+C GG+KWRDT +PN +VGAMV GP + +F
Sbjct: 501 VVGYGKKYPRRLHHRGASTPHNGIKYSCTGGYKWRDTKGADPNVLVGAMVGGPDKNDQF 559

HSP 2
Score: 31.5722 bits (70), Expect = 1.67572e-19
Identity = 19/53 (35.85%), Postives = 23/53 (43.40%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXS----GEKSVGIDKNTMFSAV 310
K+D F D R Y EPT+ + G +DKNTMFSAV
Sbjct: 555 KNDQFKDARLTYAQNEPTLVGNAGLVAALVALTNSGRGAGVTAVDKNTMFSAV 607

GUN18_ORYSJ1.18e-1155.93%
Endoglucanase 18 OS=Oryza sativa subsp. ...
HSP 1
Score: 69.3218 bits (168), Expect = 1.18255e-11
Identity = 33/59 (55.93%), Postives = 42/59 (71.19%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRF 177
+VG+G+RYP+ VHHRGASIP++ V C G KW +TSKPNPN GA+V GP + F
Sbjct: 424 LVGYGDRYPEKVHHRGASIPED-VDTGC-DGHKWLETSKPNPNVATGALVGGPYKNDSF 480

HSP 2
Score: 20.4014 bits (41), Expect = 1.18255e-11
Identity = 9/19 (47.37%), Postives = 10/19 (52.63%), Query Frame = 2
Query:  161 YKHDGFHDVRTNYNYTEPT 217
YK+D F D R N E T
Sbjct: 475 YKNDSFVDERDNVMQNEAT 493

GUN_PHAVU1.99e-1150.79%
Endoglucanase OS=Phaseolus vulgaris PE=2...
HSP 1
Score: 64.3142 bits (155), Expect = 1.99483e-11
Identity = 32/63 (50.79%), Postives = 42/63 (66.67%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKV---KYNCKGGWK-WRDTSKPNPNTIVGAMVAGPVQTRRF 177
+VGFG++YPK +HHRG+SIP KV K C G + +++ PNPNT VGA+V GP RF
Sbjct: 403 MVGFGSKYPKQLHHRGSSIPSIKVHPAKVGCNAGLSDYYNSANPNPNTHVGAIVGGPDSNDRF 465

HSP 2
Score: 24.6386 bits (52), Expect = 1.99483e-11
Identity = 8/17 (47.06%), Postives = 14/17 (82.35%), Query Frame = 2
Query:  167 HDGFHDVRTNYNYTEPT 217
+D F+D R++Y++ EPT
Sbjct: 462 NDRFNDARSDYSHAEPT 478

GUN1_PERAE4.36e-1151.79%
Endoglucanase 1 OS=Persea americana GN=C...
HSP 1
Score: 66.2402 bits (160), Expect = 4.36139e-11
Identity = 29/56 (51.79%), Postives = 41/56 (73.21%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYN---CKGGWKWRDTSKPNPNTIVGAMVAGP 159
+VGFG RYP+HVHHRG+S+P +V N C G+++ +S PNPN +VGA++ GP
Sbjct: 399 MVGFGERYPQHVHHRGSSLPSVQVHPNSIPCNAGFQYLYSSPPNPNILVGAILGGP 454

HSP 2
Score: 21.557 bits (44), Expect = 4.36139e-11
Identity = 8/15 (53.33%), Postives = 9/15 (60.00%), Query Frame = 2
Query:  170 DGFHDVRTNYNYTEP 214
D F D R NY +EP
Sbjct: 458 DSFSDDRNNYQQSEP 472

GUN10_ARATH5.75e-1150.85%
Endoglucanase 10 OS=Arabidopsis thaliana...
HSP 1
Score: 67.3958 bits (163), Expect = 5.75147e-11
Identity = 30/59 (50.85%), Postives = 40/59 (67.80%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRF 177
VVG+G++YP+ VHHRGASIP + C G+KW +++KPNPN GA+V GP F
Sbjct: 430 VVGYGDKYPQFVHHRGASIPADATT-GCLDGFKWFNSTKPNPNIAYGALVGGPFFNETF 487

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: Vaccinium_corymbosum_v1_Contig678
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0003s151401.39e-4088.68%POPTR_0003s15140.1
HSP 1
Score: 116.316 bits (290), Expect = 1.38852e-40
Identity = 47/53 (88.68%), Postives = 52/53 (98.11%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
+VGFGN YPKH+HHRGASIPKNK++YNCKGGWKWRDTSKPNPNT+VGAMVAGP
Sbjct: 501 IVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP 553

HSP 2
Score: 67.781 bits (164), Expect = 1.38852e-40
Identity = 31/49 (63.27%), Postives = 35/49 (71.43%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
+HDGFHDVRTNYNYTEPTI SG+K+ GIDKNT+FSAV
Sbjct: 555 RHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV 603

POPTR_0001s118708.84e-4090.57%POPTR_0001s11870.1
HSP 1
Score: 116.701 bits (291), Expect = 8.84474e-40
Identity = 48/53 (90.57%), Postives = 52/53 (98.11%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVGFGN YPKHVHHRGASIPKNK++YNCKGGWKWRDT+KPNPNT+VGAMVAGP
Sbjct: 501 VVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGP 553

HSP 2
Score: 64.6994 bits (156), Expect = 8.84474e-40
Identity = 30/49 (61.22%), Postives = 34/49 (69.39%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
+HDGF DVRTNYNYTEPTI SG+K+ GIDKNT+FSAV
Sbjct: 555 RHDGFRDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV 603

POPTR_0010s184805.78e-2864.41%POPTR_0010s18480.1
HSP 1
Score: 95.1301 bits (235), Expect = 5.77708e-28
Identity = 38/59 (64.41%), Postives = 47/59 (79.66%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRF 177
VVG+G ++P+H+HHRGASIP +K Y+C GGWKWRD+ KPNPN I GAMV GP + RF
Sbjct: 387 VVGYGTKFPRHIHHRGASIPNDKRSYSCTGGWKWRDSPKPNPNNITGAMVGGPDRFDRF 445

HSP 2
Score: 46.595 bits (109), Expect = 5.77708e-28
Identity = 22/49 (44.90%), Postives = 27/49 (55.10%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
+ D F DVR NYN+TEPT+ + +GIDKN MFSAV
Sbjct: 441 RFDRFRDVRKNYNFTEPTLAGNAGLVAALSSLTSSGGIGIDKNRMFSAV 489

POPTR_0008s079009.76e-2862.71%POPTR_0008s07900.1
HSP 1
Score: 93.9745 bits (232), Expect = 9.75687e-28
Identity = 37/59 (62.71%), Postives = 48/59 (81.36%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRF 177
VVG+G ++P+HVHHRGAS P +K +Y+C GGWKWRD+SKPNP+ I GAMV GP + +F
Sbjct: 502 VVGYGTKFPRHVHHRGASTPSDKTRYSCTGGWKWRDSSKPNPHNITGAMVGGPDRFDQF 560

HSP 2
Score: 46.9802 bits (110), Expect = 9.75687e-28
Identity = 21/49 (42.86%), Postives = 29/49 (59.18%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
+ D F DVRTNYN+TEPT+ + +GIDKN++F+AV
Sbjct: 556 RFDQFRDVRTNYNFTEPTLAGNAGLVAALASLTSSGGIGIDKNSIFTAV 604

POPTR_0005s210901.04e-1358.49%POPTR_0005s21090.1
HSP 1
Score: 72.7886 bits (177), Expect = 1.03975e-13
Identity = 31/53 (58.49%), Postives = 39/53 (73.58%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
+VGFGN+YP HVHHR ASIP + Y+C G +W ++ PNPN + GAMVAGP
Sbjct: 487 MVGFGNKYPTHVHHRAASIPWDDQHYSCPEGDRWLYSTDPNPNILYGAMVAGP 539

HSP 2
Score: 20.7866 bits (42), Expect = 1.03975e-13
Identity = 10/19 (52.63%), Postives = 11/19 (57.89%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTI 220
K D F D R +TEPTI
Sbjct: 541 KFDNFLDDRDKPWFTEPTI 559

POPTR_0005s258902.15e-1350.85%POPTR_0005s25890.1
HSP 1
Score: 72.4034 bits (176), Expect = 2.15396e-13
Identity = 30/59 (50.85%), Postives = 39/59 (66.10%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRF 177
+VG+G +YP++VHHRGASIP K CK GW W ++ +PNPN GA+V GP F
Sbjct: 427 LVGYGEKYPQYVHHRGASIPTG-AKTGCKDGWTWLESKEPNPNEATGALVGGPFLNETF 484

POPTR_0002s025503.67e-1350.85%POPTR_0002s02550.1
HSP 1
Score: 71.633 bits (174), Expect = 3.6741e-13
Identity = 30/59 (50.85%), Postives = 38/59 (64.41%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRF 177
+VG+G YP++VHHRGASIP + K CK GW W + +PNPN GA+V GP F
Sbjct: 428 LVGYGENYPQYVHHRGASIPAD-AKTGCKDGWTWLERKEPNPNVATGALVGGPFLNETF 485

POPTR_0001s114302.39e-1250.00%POPTR_0001s11430.1
HSP 1
Score: 67.781 bits (164), Expect = 2.39174e-12
Identity = 28/56 (50.00%), Postives = 42/56 (75.00%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPK---NKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
+VGFGNRYP+HVHHRG+S+P + + +C G+++ +S PNPN +VGA++ GP
Sbjct: 402 MVGFGNRYPQHVHHRGSSVPSIHAHPNRISCNDGFQFLYSSSPNPNVLVGAIIGGP 457

HSP 2
Score: 21.1718 bits (43), Expect = 2.39174e-12
Identity = 8/15 (53.33%), Postives = 9/15 (60.00%), Query Frame = 2
Query:  170 DGFHDVRTNYNYTEP 214
D F D R NY +EP
Sbjct: 461 DNFADDRNNYQQSEP 475

POPTR_0014s121704.02e-1244.44%POPTR_0014s12170.1
HSP 1
Score: 65.4698 bits (158), Expect = 4.02478e-12
Identity = 28/63 (44.44%), Postives = 41/63 (65.08%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPK---NKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRFP 180
+VG+G RYP+ +HHRG+S+P + K C G+ ++ PNPN +VGA+V GP + RFP
Sbjct: 415 MVGYGPRYPQRIHHRGSSLPSMAAHPAKIQCSSGFSVMNSQSPNPNILVGAIVGGPDEHDRFP 477

HSP 2
Score: 22.7126 bits (47), Expect = 4.02478e-12
Identity = 8/17 (47.06%), Postives = 12/17 (70.59%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEP 214
+HD F D R++Y +EP
Sbjct: 472 EHDRFPDERSDYEQSEP 488

POPTR_0003s147406.93e-1250.00%POPTR_0003s14740.1
HSP 1
Score: 67.3958 bits (163), Expect = 6.92906e-12
Identity = 28/56 (50.00%), Postives = 42/56 (75.00%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPK---NKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
+VGFGN+YP+HVHHRG+S+P + + +C G+++ +S PNPN +VGA+V GP
Sbjct: 419 MVGFGNKYPQHVHHRGSSVPSIHAHPNRISCNDGFQYLYSSSPNPNVLVGAIVGGP 474

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: Vaccinium_corymbosum_v1_Contig678
Best 10 Hits Shown

Match Name E value Identity Description
Q6QLN2_POPTM1.60e-3888.68%
Endo-1,4-beta-glucanase OS=Populus tremu...
HSP 1
Score: 116.316 bits (290), Expect = 1.60402e-38
Identity = 47/53 (88.68%), Postives = 52/53 (98.11%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
+VGFGN YPKH+HHRGASIPKNK++YNCKGGWKWRDTSKPNPNT+VGAMVAGP
Sbjct: 501 IVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP 553

HSP 2
Score: 67.781 bits (164), Expect = 1.60402e-38
Identity = 31/49 (63.27%), Postives = 35/49 (71.43%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
+HDGFHDVRTNYNYTEPTI SG+K+ GIDKNT+FSAV
Sbjct: 555 RHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV 603

Q6DMM4_9ROSI1.60e-3888.68%
Cel9A OS=Populus tremula x Populus tremu...
HSP 1
Score: 116.316 bits (290), Expect = 1.60402e-38
Identity = 47/53 (88.68%), Postives = 52/53 (98.11%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
+VGFGN YPKH+HHRGASIPKNK++YNCKGGWKWRDTSKPNPNT+VGAMVAGP
Sbjct: 501 IVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP 553

HSP 2
Score: 67.781 bits (164), Expect = 1.60402e-38
Identity = 31/49 (63.27%), Postives = 35/49 (71.43%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
+HDGFHDVRTNYNYTEPTI SG+K+ GIDKNT+FSAV
Sbjct: 555 RHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV 603

B9NBR6_POPTR1.60e-3888.68%
Putative uncharacterized protein POPTRKO...
HSP 1
Score: 116.316 bits (290), Expect = 1.60402e-38
Identity = 47/53 (88.68%), Postives = 52/53 (98.11%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
+VGFGN YPKH+HHRGASIPKNK++YNCKGGWKWRDTSKPNPNT+VGAMVAGP
Sbjct: 501 IVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP 553

HSP 2
Score: 67.781 bits (164), Expect = 1.60402e-38
Identity = 31/49 (63.27%), Postives = 35/49 (71.43%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
+HDGFHDVRTNYNYTEPTI SG+K+ GIDKNT+FSAV
Sbjct: 555 RHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV 603

D3JWK8_9ROSI2.72e-3888.68%
Membrane-bound endo-beta-1,4-glucanase O...
HSP 1
Score: 116.316 bits (290), Expect = 2.72261e-38
Identity = 47/53 (88.68%), Postives = 52/53 (98.11%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
+VGFGN YPKH+HHRGASIPKNK++YNCKGGWKWRDTSKPNPNT+VGAMVAGP
Sbjct: 501 IVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKPNPNTLVGAMVAGP 553

HSP 2
Score: 67.0106 bits (162), Expect = 2.72261e-38
Identity = 31/48 (64.58%), Postives = 34/48 (70.83%), Query Frame = 2
Query:  167 HDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
HDGFHDVRTNYNYTEPTI SG+K+ GIDKNT+FSAV
Sbjct: 556 HDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV 603

A5BUX9_VITVI4.62e-3886.79%
Putative uncharacterized protein OS=Viti...
HSP 1
Score: 114.39 bits (285), Expect = 4.62143e-38
Identity = 46/53 (86.79%), Postives = 51/53 (96.23%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
+ GFGN YP+HVHHRGASIPKNK+KYNCKGGWKWRD+SKPNPNT+VGAMVAGP
Sbjct: 498 IAGFGNHYPRHVHHRGASIPKNKIKYNCKGGWKWRDSSKPNPNTLVGAMVAGP 550

HSP 2
Score: 68.1662 bits (165), Expect = 4.62143e-38
Identity = 31/49 (63.27%), Postives = 35/49 (71.43%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
KHDGFHDVRTNYNYTEPT+ SG+K+ GIDKNT+FSAV
Sbjct: 552 KHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNTIFSAV 600

D7TGI4_VITVI4.63e-3886.79%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 114.39 bits (285), Expect = 4.63298e-38
Identity = 46/53 (86.79%), Postives = 51/53 (96.23%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
+ GFGN YP+HVHHRGASIPKNK+KYNCKGGWKWRD+SKPNPNT+VGAMVAGP
Sbjct: 383 IAGFGNHYPRHVHHRGASIPKNKIKYNCKGGWKWRDSSKPNPNTLVGAMVAGP 435

HSP 2
Score: 68.1662 bits (165), Expect = 4.63298e-38
Identity = 31/49 (63.27%), Postives = 35/49 (71.43%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
KHDGFHDVRTNYNYTEPT+ SG+K+ GIDKNT+FSAV
Sbjct: 437 KHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNTIFSAV 485

B9GK28_POPTR1.02e-3790.57%
Endo-1,4-beta-glucanase OS=Populus trich...
HSP 1
Score: 116.701 bits (291), Expect = 1.02183e-37
Identity = 48/53 (90.57%), Postives = 52/53 (98.11%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVGFGN YPKHVHHRGASIPKNK++YNCKGGWKWRDT+KPNPNT+VGAMVAGP
Sbjct: 501 VVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGAMVAGP 553

HSP 2
Score: 64.6994 bits (156), Expect = 1.02183e-37
Identity = 30/49 (61.22%), Postives = 34/49 (69.39%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
+HDGF DVRTNYNYTEPTI SG+K+ GIDKNT+FSAV
Sbjct: 555 RHDGFRDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV 603

A0ZNJ7_PYRCO1.44e-3688.68%
Cellulase1 OS=Pyrus communis GN=PcCL1 PE...
HSP 1
Score: 110.153 bits (274), Expect = 1.43858e-36
Identity = 47/53 (88.68%), Postives = 49/53 (92.45%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVGFGN YPKHVHHRGASIPKNK+KY+CKGGWKWRDT K NPNTI GAMVAGP
Sbjct: 504 VVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTPKANPNTIDGAMVAGP 556

HSP 2
Score: 67.3958 bits (163), Expect = 1.43858e-36
Identity = 32/49 (65.31%), Postives = 35/49 (71.43%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
KHDGF DVR+NYNYTEPT+ SGEKSVGIDKNT+FSAV
Sbjct: 558 KHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNTIFSAV 606

Q8GTP6_PYRCO1.44e-3688.68%
Endo-1,4-beta-D-glucanase OS=Pyrus commu...
HSP 1
Score: 110.153 bits (274), Expect = 1.43861e-36
Identity = 47/53 (88.68%), Postives = 49/53 (92.45%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVGFGN YPKHVHHRGASIPKNK+KY+CKGGWKWRDT K NPNTI GAMVAGP
Sbjct: 503 VVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTPKANPNTIDGAMVAGP 555

HSP 2
Score: 67.3958 bits (163), Expect = 1.43861e-36
Identity = 32/49 (65.31%), Postives = 35/49 (71.43%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
KHDGF DVR+NYNYTEPT+ SGEKSVGIDKNT+FSAV
Sbjct: 557 KHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNTIFSAV 605

Q2HSS5_MEDTR4.14e-3688.68%
Glycoside transferase, six-hairpin, subg...
HSP 1
Score: 111.694 bits (278), Expect = 4.14274e-36
Identity = 47/53 (88.68%), Postives = 50/53 (94.34%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVGFGN YPKHVHHR ASIPKNKVKYNCKGGWKWR++SKPNPN +VGAMVAGP
Sbjct: 504 VVGFGNHYPKHVHHRAASIPKNKVKYNCKGGWKWRESSKPNPNILVGAMVAGP 556

HSP 2
Score: 64.3142 bits (155), Expect = 4.14274e-36
Identity = 29/49 (59.18%), Postives = 34/49 (69.39%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
+HDGFHDVR NYNYTEPT+ SG+KS+ IDKNT+FSAV
Sbjct: 558 RHDGFHDVRKNYNYTEPTLAGNAGLVAALVALSGDKSIPIDKNTLFSAV 606

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: Vaccinium_corymbosum_v1_Contig678
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010231020012.47e-4086.79%GSVIVT01023102001 assembled CDS
HSP 1
Score: 114.39 bits (285), Expect = 2.46956e-40
Identity = 46/53 (86.79%), Postives = 51/53 (96.23%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
+ GFGN YP+HVHHRGASIPKNK+KYNCKGGWKWRD+SKPNPNT+VGAMVAGP
Sbjct: 383 IAGFGNHYPRHVHHRGASIPKNKIKYNCKGGWKWRDSSKPNPNTLVGAMVAGP 435

HSP 2
Score: 68.1662 bits (165), Expect = 2.46956e-40
Identity = 31/49 (63.27%), Postives = 35/49 (71.43%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
KHDGFHDVRTNYNYTEPT+ SG+K+ GIDKNT+FSAV
Sbjct: 437 KHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNTIFSAV 485

GSVIVT010062650012.55e-2962.71%GSVIVT01006265001 assembled CDS
HSP 1
Score: 95.1301 bits (235), Expect = 2.55234e-29
Identity = 37/59 (62.71%), Postives = 47/59 (79.66%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRF 177
+VG+G ++PKHVHHRGASIP + KY+C GGWKWRD+ PNP+ I GAMV GP++T F
Sbjct: 320 LVGYGTKFPKHVHHRGASIPNDNKKYSCTGGWKWRDSRNPNPHNITGAMVGGPIRTDNF 378

HSP 2
Score: 50.447 bits (119), Expect = 2.55234e-29
Identity = 23/47 (48.94%), Postives = 28/47 (59.57%), Query Frame = 2
Query:  170 DGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
D F D+RTNYNYTEPT+ +G + IDKNT+FSAV
Sbjct: 376 DNFQDIRTNYNYTEPTLAGNAGLVAALVSLTGSGGMSIDKNTIFSAV 422

GSVIVT010280420011.14e-1247.62%GSVIVT01028042001 assembled CDS
HSP 1
Score: 67.781 bits (164), Expect = 1.13805e-12
Identity = 30/63 (47.62%), Postives = 41/63 (65.08%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIP---KNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRFP 180
+VG+G RYP+ +HHRG+S+P K+ K C G+ + PNPN +VGA+V GP Q RFP
Sbjct: 344 MVGYGPRYPQRIHHRGSSLPSIAKHPAKIQCSAGFNIMHSQSPNPNILVGAVVGGPDQHDRFP 406

HSP 2
Score: 21.557 bits (44), Expect = 1.13805e-12
Identity = 7/18 (38.89%), Postives = 13/18 (72.22%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPT 217
+HD F D R+++ +EP+
Sbjct: 401 QHDRFPDQRSDFEQSEPS 418

GSVIVT010098810014.27e-1247.46%GSVIVT01009881001 assembled CDS
HSP 1
Score: 67.3958 bits (163), Expect = 4.26966e-12
Identity = 28/59 (47.46%), Postives = 39/59 (66.10%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRF 177
+VG+G++YP++VHHRGASIP + C G+KW + PNPN GA+V GP + F
Sbjct: 430 LVGYGDKYPQYVHHRGASIPADATT-GCSDGFKWLKSKDPNPNVATGALVGGPFKNESF 487

GSVIVT010372100011.99e-1146.88%GSVIVT01037210001 assembled CDS
HSP 1
Score: 58.9214 bits (141), Expect = 1.9922e-11
Identity = 30/64 (46.88%), Postives = 39/64 (60.94%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIP---KNKVKYNCKGGWK-WRDTSKPNPNTIVGAMVAGPVQTRRFP 180
+VGFG +PK +HHRGASIP + C G++ + TS PNPN + GA+V GP Q FP
Sbjct: 399 MVGFGANFPKRIHHRGASIPSKASHPEAIGCDSGFQSFFYTSNPNPNILTGAIVGGPNQNDGFP 462

HSP 2
Score: 26.1794 bits (56), Expect = 1.9922e-11
Identity = 9/17 (52.94%), Postives = 15/17 (88.24%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEP 214
++DGF D RT+Y+++EP
Sbjct: 457 QNDGFPDERTDYSHSEP 473

GSVIVT010194200012.58e-1144.44%GSVIVT01019420001 assembled CDS
HSP 1
Score: 59.3066 bits (142), Expect = 2.58302e-11
Identity = 28/63 (44.44%), Postives = 40/63 (63.49%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKV---KYNCKGGW-KWRDTSKPNPNTIVGAMVAGPVQTRRF 177
++G+G++YP +HHRGASIP K C G+ W +++PNPNT VGA+V GP +F
Sbjct: 398 MLGYGSKYPTQLHHRGASIPSIHALPDKVGCNQGYSSWYSSTEPNPNTHVGAIVGGPNSDDQF 460

HSP 2
Score: 25.409 bits (54), Expect = 2.58302e-11
Identity = 9/16 (56.25%), Postives = 14/16 (87.50%), Query Frame = 2
Query:  170 DGFHDVRTNYNYTEPT 217
D F DVR++Y+++EPT
Sbjct: 458 DQFSDVRSDYSHSEPT 473

GSVIVT010187930013.61e-1152.83%GSVIVT01018793001 assembled CDS
HSP 1
Score: 64.3142 bits (155), Expect = 3.61449e-11
Identity = 28/53 (52.83%), Postives = 38/53 (71.70%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
+VG G+ YP++VHHRGASIP + + C G+KW ++ PNPN VGA+V GP
Sbjct: 431 LVGHGSNYPQYVHHRGASIPVD-AETGCHDGFKWLESLDPNPNLAVGALVGGP 482

GSVIVT010120430013.46e-1042.11%GSVIVT01012043001 assembled CDS
HSP 1
Score: 50.0618 bits (118), Expect = 3.45562e-10
Identity = 24/57 (42.11%), Postives = 34/57 (59.65%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYN---CKGGWK-WRDTSKPNPNTIVGAMVAGP 159
+VG+G +YP H HHRG+SI V ++ C G++ W + NPN I G +V GP
Sbjct: 403 LVGYGQKYPVHAHHRGSSIASVAVLHSTVGCVEGFESWYHRPEANPNVIYGGLVGGP 459

HSP 2
Score: 30.8018 bits (68), Expect = 3.45562e-10
Identity = 12/19 (63.16%), Postives = 15/19 (78.95%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTI 220
K+DGF D R+NY TEPT+
Sbjct: 461 KNDGFSDDRSNYEQTEPTL 479

GSVIVT010195230011.64e-0945.61%GSVIVT01019523001 assembled CDS
HSP 1
Score: 55.0694 bits (131), Expect = 1.63887e-09
Identity = 26/57 (45.61%), Postives = 36/57 (63.16%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVK---YNCKGGW-KWRDTSKPNPNTIVGAMVAGP 159
+VG+GN YP+ VHHRG+SI KV +C+GG+ W +PN + GA+V GP
Sbjct: 404 MVGYGNNYPRQVHHRGSSIVSIKVNPSFVSCRGGYATWFSRKGSDPNLLTGAIVGGP 460

HSP 2
Score: 23.483 bits (49), Expect = 1.63887e-09
Identity = 9/16 (56.25%), Postives = 10/16 (62.50%), Query Frame = 2
Query:  167 HDGFHDVRTNYNYTEP 214
+D F D R NY TEP
Sbjct: 463 YDNFADERDNYEQTEP 478

GSVIVT010354810012.59e-0943.55%GSVIVT01035481001 assembled CDS
HSP 1
Score: 58.151 bits (139), Expect = 2.59032e-09
Identity = 27/62 (43.55%), Postives = 35/62 (56.45%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWK---WRDTSKPNPNTIVGAMVAGPVQTRRF 177
+VGFGN P H HHRG+S+PK Y G W ++PNPN + GA+V GP + F
Sbjct: 878 MVGFGNNPPTHAHHRGSSVPKLPENYTVNCGMSFVYWFHKNEPNPNMLTGAIVGGPDRNDTF 939

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: Vaccinium_corymbosum_v1_Contig678
Best 10 Hits Shown

Match Name E value Identity Description
AT5G49720.1 5.58e-3488.68%
glycosyl hydrolase 9A1 | chr5:20197765-...
HSP 1
Score: 112.079 bits (279), Expect = 5.57555e-34
Identity = 47/53 (88.68%), Postives = 50/53 (94.34%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVGFG +YP+HVHHRGASIPKNKVKYNCKGGWKWRD+ KPNPNTI GAMVAGP
Sbjct: 501 VVGFGTKYPRHVHHRGASIPKNKVKYNCKGGWKWRDSKKPNPNTIEGAMVAGP 553

HSP 2
Score: 49.6766 bits (117), Expect = 5.57555e-34
Identity = 26/51 (50.98%), Postives = 30/51 (58.82%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSV--GIDKNTMFSAV 310
K DG+ DVR NYNYTEPT+ SGE+ IDKNT+FSAV
Sbjct: 555 KRDGYRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDKNTIFSAV 605

AT4G24260.1 5.74e-3069.81%
glycosyl hydrolase 9A3 | chr4:12577871-...
HSP 1
Score: 80.8777 bits (198), Expect = 5.7368e-30
Identity = 37/53 (69.81%), Postives = 42/53 (79.25%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVG+G RYPK VHHRGASIPKN +K C GG+KW+ + K NPN I GAMVAGP
Sbjct: 502 VVGYGQRYPKQVHHRGASIPKN-MKETCTGGFKWKKSKKNNPNAINGAMVAGP 553

HSP 2
Score: 67.3958 bits (163), Expect = 5.7368e-30
Identity = 33/50 (66.00%), Postives = 36/50 (72.00%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSV-GIDKNTMFSAV 310
KHDGFHD+RTNYNYTEPT+ SGEK+V GIDKNTMFSAV
Sbjct: 555 KHDGFHDIRTNYNYTEPTLAGNAGLVAALVALSGEKAVGGIDKNTMFSAV 604

AT1G65610.1 2.17e-2160.38%
Six-hairpin glycosidases superfamily pr...
HSP 1
Score: 77.7962 bits (190), Expect = 2.1686e-21
Identity = 32/53 (60.38%), Postives = 41/53 (77.36%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
VVGFG ++P+ VHHRGA+IP +K + +C+ G K+RDT PNPN I GAMV GP
Sbjct: 505 VVGFGKKFPRRVHHRGATIPNDKKRRSCREGLKYRDTKNPNPNNITGAMVGGP 557

HSP 2
Score: 41.5874 bits (96), Expect = 2.1686e-21
Identity = 20/49 (40.82%), Postives = 26/49 (53.06%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEPTIXXXXXXXXXXXXXSGEKSVGIDKNTMFSAV 310
K D FHD+R NYN +EPT+ + IDKNTMF++V
Sbjct: 559 KFDEFHDLRNNYNASEPTLSGNAGLVAALVSLTSSGGQQIDKNTMFNSV 607

AT1G75680.1 6.11e-1250.85%
glycosyl hydrolase 9B7 | chr1:28417215-...
HSP 1
Score: 67.3958 bits (163), Expect = 6.10989e-12
Identity = 30/59 (50.85%), Postives = 40/59 (67.80%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRF 177
VVG+G++YP+ VHHRGASIP + C G+KW +++KPNPN GA+V GP F
Sbjct: 430 VVGYGDKYPQFVHHRGASIPADATT-GCLDGFKWFNSTKPNPNIAYGALVGGPFFNETF 487

AT1G19940.1 7.98e-1252.83%
glycosyl hydrolase 9B5 | chr1:6918323-6...
HSP 1
Score: 67.0106 bits (162), Expect = 7.97977e-12
Identity = 28/53 (52.83%), Postives = 38/53 (71.70%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGP 159
+VG+G +YP+ VHHRGASIP + CK G+KW ++ +PNPN GA+V GP
Sbjct: 421 LVGYGEKYPEFVHHRGASIPADATT-GCKDGFKWLNSDEPNPNVAYGALVGGP 472

AT4G02290.1 2.85e-1142.86%
glycosyl hydrolase 9B13 | chr4:1002654-...
HSP 1
Score: 62.3882 bits (150), Expect = 2.84973e-11
Identity = 27/63 (42.86%), Postives = 41/63 (65.08%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIP---KNKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRFP 180
+VG+G ++P+ +HHRG+S+P + K C G+ ++ PNPN +VGA+V GP Q RFP
Sbjct: 421 MVGYGPKFPRRIHHRGSSLPCVASHPAKIQCHQGFAIMNSQSPNPNFLVGAVVGGPDQHDRFP 483

HSP 2
Score: 22.7126 bits (47), Expect = 2.84973e-11
Identity = 8/17 (47.06%), Postives = 12/17 (70.59%), Query Frame = 2
Query:  164 KHDGFHDVRTNYNYTEP 214
+HD F D R++Y +EP
Sbjct: 478 QHDRFPDERSDYEQSEP 494

AT1G22880.2 3.03e-1144.44%
cellulase 5 | chr1:8096103-8097539 FORW...
HSP 1
Score: 65.0846 bits (157), Expect = 3.03231e-11
Identity = 28/63 (44.44%), Postives = 40/63 (63.49%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYN---CKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRFP 180
+VGF + +PK +HHRG+S+P V+ N C GG++ T PNPN + GA+V GP Q +P
Sbjct: 306 MVGFSSNFPKRIHHRGSSLPSRAVRSNSLGCNGGFQSFRTQNPNPNILTGAIVGGPNQNDEYP 368

AT1G22880.1 3.03e-1144.44%
cellulase 5 | chr1:8095770-8097539 FORW...
HSP 1
Score: 65.0846 bits (157), Expect = 3.03231e-11
Identity = 28/63 (44.44%), Postives = 40/63 (63.49%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKVKYN---CKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRFP 180
+VGF + +PK +HHRG+S+P V+ N C GG++ T PNPN + GA+V GP Q +P
Sbjct: 390 MVGFSSNFPKRIHHRGSSLPSRAVRSNSLGCNGGFQSFRTQNPNPNILTGAIVGGPNQNDEYP 452

AT1G02800.1 3.35e-1042.86%
cellulase 2 | chr1:613386-616103 REVERS...
HSP 1
Score: 61.6178 bits (148), Expect = 3.35261e-10
Identity = 27/63 (42.86%), Postives = 40/63 (63.49%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPKNKV---KYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRFP 180
+VG+G +YP+ +HHRG+S+P V + C G+ + PNPN +VGA+V GP Q +FP
Sbjct: 410 MVGYGLKYPRRIHHRGSSLPSVAVHPTRIQCHDGFSLFTSQSPNPNDLVGAVVGGPDQNDQFP 472

AT1G23210.1 4.38e-1041.27%
glycosyl hydrolase 9B6 | chr1:8240174-8...
HSP 1
Score: 61.2326 bits (147), Expect = 4.37864e-10
Identity = 26/63 (41.27%), Postives = 43/63 (68.25%), Query Frame = 1
Query:    1 VVGFGNRYPKHVHHRGASIPK---NKVKYNCKGGWKWRDTSKPNPNTIVGAMVAGPVQTRRFP 180
+VG+G+R+P+ +HHRG+S+P + + CK G ++ ++ PNPN ++GA+V GP T FP
Sbjct: 397 MVGYGSRFPQKIHHRGSSVPSVVDHPDRIGCKDGSRYFFSNNPNPNLLIGAVVGGPNITDDFP 459

Related info for Vaccinium_corymbosum_v1_Contig678