Vaccinium_corymbosum_v1_Contig710

Information for Vaccinium_corymbosum_v1_Contig710

NameVaccinium_corymbosum_v1_Contig710
AccessionID5500
Length494 bp
Typecontig
Organism highbush blueberry (Vaccinium corymbosum)
Sequence
GTCTTCATTTCCCCTCTCTCCTCAATTCGCCTCTCCCTCATCCTCGCAGACCAAAATGCC
GTTCAAGCGTTACGTCGAGATCGGGAGGGTGGCTCTGGTTAACTACGGCAAGGAATATGG
GAGACTCGTCNCNTATCGTCGCCGTTATCGACCNAAACAGGGCTCTTGTAGGATGCCCCT
GACATGGNGAGATGCCANATGAACTTTAAGAGGCTTTCTCTCACTGACATCACCATTGAC
ATCAAAAGGGCCCCAAAGAAGAAAACACTGATTGCTGCAATGGAGGCTGCAGATGTTAAG
AACAAGTGGGAGAACAGCTCCTGGGGCATAAAGCTGATTGTGCATAAAAGAAGGGCCGCT
CTTAATGATTTTGATAGGNTCAAGCTCATGTTGGCAAAAATCAAGAGGGGTGGACTGATC
ANAAAAGAGCTTGCGAAGCTGAAAAAGCAGAATGCAGCCTAAGCATAACGTTTCTATGAT
CATGCCCGAATNNT
Download sequence in fasta format

Comprising EST/subcontigs

Type Feature Position
EST CF811321 0-148
EST CF811622 6-494

GO terms assigned to this feature

Accession Category Term
GO:0006412 biological_process translation
GO:0005622 cellular_component intracellular
GO:0005840 cellular_component ribosome
GO:0003735 molecular_function structural constituent of ribosome

KEGG Analysis

Analysis Date: 01-18-2011 (KEGG analysis for Vaccinium corymbosum unigene v1)
K02875 RP-L14e, RPL14; large subunit ribosomal protein L14e

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: Vaccinium_corymbosum_v1_Contig710_1_ORF2 CRC64: 903177EC7A49EC25 LENGTH: 96 aa
InterPro
IPR002784
Domain
Ribosomal protein L14
PF01929 [7-79]T 1.1e-26 PF01929 Ribosomal_L14e Ribosomal_L14e
InterPro
IPR014722
Domain
Translation protein SH3-like, subgroup
G3DSA:2.30.30.30 [5-47]T 4.1e-05 G3DSA:2.30.30.30 no description no description
noIPR
unintegrated
unintegrated
PTHR11127 [1-96]T 6.8e-27 PTHR11127 60S RIBOSOMAL PROTEIN L14 60S RIBOSOMAL PROTEIN L14
SEQUENCE: Vaccinium_corymbosum_v1_Contig710_2_ORF1 CRC64: CEBCED8C80410787 LENGTH: 65 aa
noIPR
unintegrated
unintegrated
PTHR11127 [20-43]T 3.8e-08 PTHR11127 60S RIBOSOMAL PROTEIN L14 60S RIBOSOMAL PROTEIN L14
seg [44-50]? NA seg seg seg
SEQUENCE: Vaccinium_corymbosum_v1_Contig710_6_ORF2 CRC64: 3D2A09F5A9355ED5 LENGTH: 119 aa
noIPR
unintegrated
unintegrated
seg [1-13]? NA seg seg[25-38]? NA seg seg[56-64]? NA seg seg[101-112]? NA seg seg seg

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: Vaccinium_corymbosum_v1_Contig710
Best 10 Hits Shown

Match Name E value Identity Description
ppa013223m 2.31e-4585.54%ppa013223m
HSP 1
Score: 143.665 bits (361), Expect = 2.31297e-45
Identity = 71/83 (85.54%), Postives = 75/83 (90.36%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM R +NFKRL+LTDITIDIKR PKKKTL+AAMEAADVKNKWENSSWG KLIV KRRAALNDFDR KLMLAKIKR G+I
Sbjct: 39 DAPDMVRTQLNFKRLTLTDITIDIKRVPKKKTLLAAMEAADVKNKWENSSWGRKLIVQKRRAALNDFDRFKLMLAKIKRAGII 121

HSP 2
Score: 53.5286 bits (127), Expect = 2.31297e-45
Identity = 24/25 (96.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKRYVEIGRVALVNYGK+YGRLV
Sbjct: 1 MPFKRYVEIGRVALVNYGKDYGRLV 25

HSP 3
Score: 22.7126 bits (47), Expect = 2.31297e-45
Identity = 11/23 (47.83%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  111 RNMGDSSXIVAVIDXNRALVGCP 179
++ G IV V+D NRALV P
Sbjct: 19 KDYGRLVVIVDVLDQNRALVDAP 41

ppa013229m 3.40e-4384.34%ppa013229m
HSP 1
Score: 139.428 bits (350), Expect = 3.40345e-43
Identity = 70/83 (84.34%), Postives = 72/83 (86.75%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM R MNFKRLSLTDI IDIKR PKKK L+AAMEAADVK KWENSSWG KLIV KRRAALNDFDR KLMLAKIKR GL+
Sbjct: 39 DAPDMVRSQMNFKRLSLTDIKIDIKRVPKKKELLAAMEAADVKKKWENSSWGRKLIVQKRRAALNDFDRFKLMLAKIKRAGLV 121

HSP 2
Score: 50.8322 bits (120), Expect = 3.40345e-43
Identity = 22/25 (88.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKRYVEIGRVALVNYG++YG+LV
Sbjct: 1 MPFKRYVEIGRVALVNYGEDYGKLV 25

HSP 3
Score: 22.3274 bits (46), Expect = 3.40345e-43
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV V+D NRALV P
Sbjct: 27 IVDVLDQNRALVDAP 41

ppa013222m 2.14e-4281.93%ppa013222m
HSP 1
Score: 137.117 bits (344), Expect = 2.1389e-42
Identity = 68/83 (81.93%), Postives = 72/83 (86.75%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
D+PDM R MNFKRLSLTDI IDIKR PKKK L+AAMEAADVK KWENSSWG KLIV KRRA+LNDFDR KLMLAKIKR GL+
Sbjct: 39 DSPDMVRSQMNFKRLSLTDIKIDIKRVPKKKELLAAMEAADVKKKWENSSWGRKLIVQKRRASLNDFDRFKLMLAKIKRAGLV 121

HSP 2
Score: 50.8322 bits (120), Expect = 2.1389e-42
Identity = 22/25 (88.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKRYVEIGRVALVNYG++YG+LV
Sbjct: 1 MPFKRYVEIGRVALVNYGEDYGKLV 25

HSP 3
Score: 21.9422 bits (45), Expect = 2.1389e-42
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV V+D NRALV P
Sbjct: 27 IVDVLDQNRALVDSP 41

ppa013377m 1.10e-4082.50%ppa013377m
HSP 1
Score: 131.339 bits (329), Expect = 1.10051e-40
Identity = 66/80 (82.50%), Postives = 69/80 (86.25%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRG 411
D+PDM R MNFKRLSLTDI IDIKR PKKK L+AAMEAADVK KWENSSWG KLIV KRRA+LNDFDR KLMLAKIK G
Sbjct: 39 DSPDMVRSQMNFKRLSLTDIKIDIKRVPKKKELLAAMEAADVKKKWENSSWGRKLIVQKRRASLNDFDRFKLMLAKIKVG 118

HSP 2
Score: 50.8322 bits (120), Expect = 1.10051e-40
Identity = 22/25 (88.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKRYVEIGRVALVNYG++YG+LV
Sbjct: 1 MPFKRYVEIGRVALVNYGEDYGKLV 25

HSP 3
Score: 21.9422 bits (45), Expect = 1.10051e-40
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV V+D NRALV P
Sbjct: 27 IVDVLDQNRALVDSP 41

ppb022686m 1.02e-1765.57%ppb022686m
HSP 1
Score: 85.8853 bits (211), Expect = 1.01515e-17
Identity = 40/61 (65.57%), Postives = 48/61 (78.69%), Query Frame = 1
Query:  178 PDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAA 360
P C MNFKRLS++ I IDIK PKKK L+AAM+ ADVK KWENSSWG++LIVH+R A+
Sbjct: 102 PSTMLCQMNFKRLSVSYIKIDIKMVPKKKELLAAMKVADVKKKWENSSWGMQLIVHRRSAS 162

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: Vaccinium_corymbosum_v1_Contig710
Best 10 Hits Shown

Match Name E value Identity Description
RL141_ARATH2.17e-3878.31%
60S ribosomal protein L14-1 OS=Arabidops...
HSP 1
Score: 131.339 bits (329), Expect = 2.17253e-38
Identity = 65/83 (78.31%), Postives = 68/83 (81.93%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM R MN KRLSLTDI IDI R PKKK LI AME ADVKNKWE SSWG KLIV KRRAALNDFDR K+MLAKIKR G++
Sbjct: 39 DAPDMERIQMNLKRLSLTDIVIDINRVPKKKVLIEAMEKADVKNKWEKSSWGRKLIVQKRRAALNDFDRFKIMLAKIKRAGIV 121

HSP 2
Score: 45.8246 bits (107), Expect = 2.17253e-38
Identity = 20/25 (80.00%), Postives = 24/25 (96.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
M FKR+VEIGRVALVNYG++YG+LV
Sbjct: 1 MGFKRFVEIGRVALVNYGEDYGKLV 25

HSP 3
Score: 22.7126 bits (47), Expect = 2.17253e-38
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV V+D NRALV P
Sbjct: 27 IVDVVDQNRALVDAP 41

RL142_ARATH8.06e-3877.11%
60S ribosomal protein L14-2 OS=Arabidops...
HSP 1
Score: 129.798 bits (325), Expect = 8.06309e-38
Identity = 64/83 (77.11%), Postives = 68/83 (81.93%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM R MNFKRLSLTDI IDI R PKKK LI AME ADVKNKWE SSWG KLIV KRRA LNDFDR K+MLAKIK+ G++
Sbjct: 39 DAPDMERIQMNFKRLSLTDIVIDINRVPKKKALIEAMEKADVKNKWEKSSWGRKLIVQKRRANLNDFDRFKIMLAKIKKAGVV 121

HSP 2
Score: 45.4394 bits (106), Expect = 8.06309e-38
Identity = 20/25 (80.00%), Postives = 24/25 (96.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
M FKRYVEIGRVALVNYG+++G+LV
Sbjct: 1 MGFKRYVEIGRVALVNYGEDHGKLV 25

HSP 3
Score: 22.7126 bits (47), Expect = 8.06309e-38
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV V+D NRALV P
Sbjct: 27 IVDVVDQNRALVDAP 41

RL14_PEA1.77e-3778.48%
Probable 60S ribosomal protein L14 OS=Pi...
HSP 1
Score: 124.02 bits (310), Expect = 1.77202e-37
Identity = 62/79 (78.48%), Postives = 66/79 (83.54%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKR 408
DAPDM R +NFKRLSLTD+ IDIKR PKKK LI A+EAADVKNKW SSWG KLIV K RAALNDFDR K+MLAKIKR
Sbjct: 39 DAPDMERSPINFKRLSLTDLKIDIKRVPKKKDLIKALEAADVKNKWAKSSWGRKLIVKKTRAALNDFDRFKIMLAKIKR 117

HSP 2
Score: 51.6026 bits (122), Expect = 1.77202e-37
Identity = 22/25 (88.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKR+VEIGRVAL+NYGK+YGRLV
Sbjct: 1 MPFKRFVEIGRVALINYGKDYGRLV 25

HSP 3
Score: 21.1718 bits (43), Expect = 1.77202e-37
Identity = 11/23 (47.83%), Postives = 13/23 (56.52%), Query Frame = 3
Query:  111 RNMGDSSXIVAVIDXNRALVGCP 179
++ G IV VID RALV P
Sbjct: 19 KDYGRLVVIVDVIDQTRALVDAP 41

RL14_MOUSE3.06e-1236.36%
60S ribosomal protein L14 OS=Mus musculu...
HSP 1
Score: 56.225 bits (134), Expect = 3.06282e-12
Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 1
Query:  190 RCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
R M FK + LTD + + ++K + A E AD+ KW + W K+ +R+A + DFDR K+M AK R +I
Sbjct: 47 RQAMPFKCMQLTDFILKFPHSARQKYVRKAWEKADINTKWAATRWAKKIDARERKAKMTDFDRFKVMKAKKMRNRII 123

HSP 2
Score: 35.039 bits (79), Expect = 3.06282e-12
Identity = 14/25 (56.00%), Postives = 20/25 (80.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
M F+RYVE+GRVA +++G G+LV
Sbjct: 1 MVFRRYVEVGRVAYISFGPHAGKLV 25

RL14_HUMAN5.69e-1235.06%
60S ribosomal protein L14 OS=Homo sapien...
HSP 1
Score: 53.9138 bits (128), Expect = 5.68929e-12
Identity = 27/77 (35.06%), Postives = 41/77 (53.25%), Query Frame = 1
Query:  190 RCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
R M FK + LTD + + +K + A + AD+ KW + W K+ +R+A + DFDR K+M AK R +I
Sbjct: 47 RQAMPFKCMQLTDFILKFPHSAHQKYVRQAWQKADINTKWAATRWAKKIEARERKAKMTDFDRFKVMKAKKMRNRII 123

HSP 2
Score: 33.8834 bits (76), Expect = 5.68929e-12
Identity = 14/25 (56.00%), Postives = 20/25 (80.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
M F+R+VE+GRVA V++G G+LV
Sbjct: 1 MVFRRFVEVGRVAYVSFGPHAGKLV 25

HSP 3
Score: 21.9422 bits (45), Expect = 5.68929e-12
Identity = 11/15 (73.33%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV VID NRALV P
Sbjct: 27 IVDVIDQNRALVDGP 41

RL14_BOVIN5.69e-1235.06%
60S ribosomal protein L14 OS=Bos taurus ...
HSP 1
Score: 53.9138 bits (128), Expect = 5.69143e-12
Identity = 27/77 (35.06%), Postives = 42/77 (54.55%), Query Frame = 1
Query:  190 RCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
R M FK + LTD + + ++K + A E AD+ KW + W K+ +++A + DFDR K+M A+ R LI
Sbjct: 47 RQAMPFKCMQLTDFILKFPHSARQKYVRKAWEKADINAKWAATRWAKKIEAREKKAKMTDFDRYKVMKARKMRNRLI 123

HSP 2
Score: 33.8834 bits (76), Expect = 5.69143e-12
Identity = 14/25 (56.00%), Postives = 20/25 (80.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
M F+R+VE+GRVA V++G G+LV
Sbjct: 1 MVFRRFVEVGRVAYVSFGPHAGKLV 25

HSP 3
Score: 21.9422 bits (45), Expect = 5.69143e-12
Identity = 11/15 (73.33%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV VID NRALV P
Sbjct: 27 IVDVIDQNRALVDGP 41

RL14_PIG5.69e-1235.06%
60S ribosomal protein L14 OS=Sus scrofa ...
HSP 1
Score: 53.9138 bits (128), Expect = 5.69359e-12
Identity = 27/77 (35.06%), Postives = 42/77 (54.55%), Query Frame = 1
Query:  190 RCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
R M FK + LTD + + ++K + A E AD+ KW + W K+ +++A + DFDR K+M A+ R LI
Sbjct: 47 RQAMPFKCMQLTDFILKFPHSARQKYVRKAWEKADINAKWAATRWAKKIEAREKKAKMTDFDRYKVMKARKMRNRLI 123

HSP 2
Score: 33.8834 bits (76), Expect = 5.69359e-12
Identity = 14/25 (56.00%), Postives = 20/25 (80.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
M F+R+VE+GRVA V++G G+LV
Sbjct: 1 MVFRRFVEVGRVAYVSFGPHAGKLV 25

HSP 3
Score: 21.9422 bits (45), Expect = 5.69359e-12
Identity = 11/15 (73.33%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV VID NRALV P
Sbjct: 27 IVDVIDQNRALVDGP 41

RL14_RAT8.71e-1236.36%
60S ribosomal protein L14 OS=Rattus norv...
HSP 1
Score: 56.225 bits (134), Expect = 8.71005e-12
Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 1
Query:  190 RCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
R M FK + LTD + + ++K + A E AD+ KW + W K+ +R+A + DFDR K+M AK R +I
Sbjct: 47 RQAMPFKCMQLTDFILKFPHSARQKYVRKAWEKADINTKWAATRWAKKIDARERKAKMTDFDRFKVMKAKKMRNRII 123

HSP 2
Score: 33.4982 bits (75), Expect = 8.71005e-12
Identity = 13/25 (52.00%), Postives = 20/25 (80.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
M F+R+VE+GRVA +++G G+LV
Sbjct: 1 MVFRRFVEVGRVAYISFGPHAGKLV 25

RL14_LUMRU9.84e-1237.66%
60S ribosomal protein L14 OS=Lumbricus r...
HSP 1
Score: 52.7582 bits (125), Expect = 9.84281e-12
Identity = 29/77 (37.66%), Postives = 39/77 (50.65%), Query Frame = 1
Query:  190 RCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
R MNFK L LT++ + K + A E ++ KWE S K+ ++R L DF+R KLM AK R LI
Sbjct: 47 RKSMNFKELELTNLKAKFPHSAKTGVVKKAWEKDEISKKWEESHLAKKIAAKEKRKTLTDFERFKLMKAKQARNRLI 123

HSP 2
Score: 33.8834 bits (76), Expect = 9.84281e-12
Identity = 15/25 (60.00%), Postives = 19/25 (76.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
M F+R+VEIGRVA YG + G+LV
Sbjct: 1 MSFRRFVEIGRVARAVYGPDQGKLV 25

HSP 3
Score: 22.3274 bits (46), Expect = 9.84281e-12
Identity = 12/22 (54.55%), Postives = 13/22 (59.09%), Query Frame = 3
Query:  114 NMGDSSXIVAVIDXNRALVGCP 179
+ G IV VID NRALV P
Sbjct: 20 DQGKLVAIVDVIDQNRALVDGP 41

RL14_GRIJA1.22e-1037.21%
60S ribosomal protein L14 OS=Griffithsia...
HSP 1
Score: 51.9878 bits (123), Expect = 1.22347e-10
Identity = 32/86 (37.21%), Postives = 49/86 (56.98%), Query Frame = 1
Query:  172 DAPD--MXRCXMNFKRLSLTDITID-IKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
D+P + R +N KR++LT I +D I R + + AA V + S WG KL ++RAAL+DF R K+M+A++K+ I
Sbjct: 39 DSPSHGLKRKVINVKRIALTSIKVDDIARGAPVAEVKSKYTAAKVDETFAASGWGKKLAKREKRAALDDFGRFKVMVARMKKSKAI 124

HSP 2
Score: 33.8834 bits (76), Expect = 1.22347e-10
Identity = 15/25 (60.00%), Postives = 19/25 (76.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
M F R+VE GRVALV+YG+ +LV
Sbjct: 1 MTFTRFVEAGRVALVSYGEHLNKLV 25

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: Vaccinium_corymbosum_v1_Contig710
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0010s080602.82e-4383.13%POPTR_0010s08060.1
HSP 1
Score: 137.887 bits (346), Expect = 2.82329e-43
Identity = 69/83 (83.13%), Postives = 71/83 (85.54%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM R MNFKR+SLTDI IDI R PKKK LI AME ADVKNKWENSSWG +LIV KRRAALNDFDR KLMLAKIKRGGLI
Sbjct: 39 DAPDMVRSQMNFKRISLTDIKIDINRVPKKKALIEAMEKADVKNKWENSSWGRRLIVQKRRAALNDFDRFKLMLAKIKRGGLI 121

HSP 2
Score: 52.373 bits (124), Expect = 2.82329e-43
Identity = 23/25 (92.00%), Postives = 24/25 (96.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKRYVEIGRV LVNYGKEYGR+V
Sbjct: 1 MPFKRYVEIGRVGLVNYGKEYGRIV 25

HSP 3
Score: 23.0978 bits (48), Expect = 2.82329e-43
Identity = 11/15 (73.33%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV VID NRALV P
Sbjct: 27 IVDVIDQNRALVDAP 41

POPTR_0008s168401.36e-4280.72%POPTR_0008s16840.1
HSP 1
Score: 133.265 bits (334), Expect = 1.36477e-42
Identity = 67/83 (80.72%), Postives = 70/83 (84.34%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM R MNFKRLSLTDI I+I R PKKK LI AME ADVKNKWE SSWG +LIV +RRAALNDFDR KLMLAKIKRGGLI
Sbjct: 39 DAPDMVRSQMNFKRLSLTDIKIEINRVPKKKALIEAMEKADVKNKWEKSSWGRRLIVQQRRAALNDFDRFKLMLAKIKRGGLI 121

HSP 2
Score: 54.6842 bits (130), Expect = 1.36477e-42
Identity = 25/25 (100.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKRYVEIGRVALVNYGKEYGRLV
Sbjct: 1 MPFKRYVEIGRVALVNYGKEYGRLV 25

HSP 3
Score: 23.0978 bits (48), Expect = 1.36477e-42
Identity = 11/15 (73.33%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV VID NRALV P
Sbjct: 27 IVDVIDQNRALVDAP 41

POPTR_0005s248905.39e-4175.90%POPTR_0005s24890.1
HSP 1
Score: 129.413 bits (324), Expect = 5.38703e-41
Identity = 63/83 (75.90%), Postives = 69/83 (83.13%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM R MNFKRLSLTDI I+I R PKKK LI AME ADVKNKWENSSWG +L V KRRA+LNDFDR KLMLAKIK+ G++
Sbjct: 39 DAPDMVRSQMNFKRLSLTDIKIEINRVPKKKALIEAMEKADVKNKWENSSWGRRLTVQKRRASLNDFDRFKLMLAKIKKAGIV 121

HSP 2
Score: 52.373 bits (124), Expect = 5.38703e-41
Identity = 23/25 (92.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKRYVEIGRVALVNYGK+YG+LV
Sbjct: 1 MPFKRYVEIGRVALVNYGKDYGKLV 25

HSP 3
Score: 23.8682 bits (50), Expect = 5.38703e-41
Identity = 12/23 (52.17%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  111 RNMGDSSXIVAVIDXNRALVGCP 179
++ G IV VID NRALV P
Sbjct: 19 KDYGKLVVIVDVIDQNRALVDAP 41

POPTR_0002s037005.39e-4175.90%POPTR_0002s03700.1
HSP 1
Score: 129.413 bits (324), Expect = 5.38703e-41
Identity = 63/83 (75.90%), Postives = 69/83 (83.13%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM R MNFKRLSLTDI I+I R PKKK LI AME ADVKNKWENSSWG +L V KRRA+LNDFDR KLMLAKIK+ G++
Sbjct: 39 DAPDMVRSQMNFKRLSLTDIKIEINRVPKKKALIEAMEKADVKNKWENSSWGRRLTVQKRRASLNDFDRFKLMLAKIKKAGIV 121

HSP 2
Score: 52.373 bits (124), Expect = 5.38703e-41
Identity = 23/25 (92.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKRYVEIGRVALVNYGK+YG+LV
Sbjct: 1 MPFKRYVEIGRVALVNYGKDYGKLV 25

HSP 3
Score: 23.8682 bits (50), Expect = 5.38703e-41
Identity = 12/23 (52.17%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  111 RNMGDSSXIVAVIDXNRALVGCP 179
++ G IV VID NRALV P
Sbjct: 19 KDYGKLVVIVDVIDQNRALVDAP 41

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: Vaccinium_corymbosum_v1_Contig710
Best 10 Hits Shown

Match Name E value Identity Description
D7T502_VITVI1.71e-4585.54%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 144.436 bits (363), Expect = 1.70944e-45
Identity = 71/83 (85.54%), Postives = 74/83 (89.16%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM RC MNFKRLSLTDI IDIKR PKKKTLI AM AADVKNKWENSSWG KLIV KRRA+LNDFDR K+MLAKIKRGG+I
Sbjct: 84 DAPDMVRCQMNFKRLSLTDIKIDIKRVPKKKTLIEAMNAADVKNKWENSSWGRKLIVQKRRASLNDFDRFKIMLAKIKRGGVI 166

HSP 2
Score: 60.077 bits (144), Expect = 1.70944e-45
Identity = 28/31 (90.32%), Postives = 29/31 (93.55%), Query Frame = 2
Query:   38 SSSQTKMPFKRYVEIGRVALVNYGKEYGRLV 130
S +Q KMPFKRYVEIGRVALVNYGKEYGRLV
Sbjct: 40 SHAQAKMPFKRYVEIGRVALVNYGKEYGRLV 70

HSP 3
Score: 23.0978 bits (48), Expect = 1.70944e-45
Identity = 11/15 (73.33%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV VID NRALV P
Sbjct: 72 IVDVIDQNRALVDAP 86

D7SZI9_VITVI6.72e-4485.54%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 144.05 bits (362), Expect = 6.72441e-44
Identity = 71/83 (85.54%), Postives = 74/83 (89.16%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM RC MNFKRLSLTDI IDIKR PKKKTLI AM AADVKNKWENSSWG KLIV KRRA+LNDFDR K+MLAKIKRGG+I
Sbjct: 125 DAPDMVRCQMNFKRLSLTDIKIDIKRVPKKKTLIEAMTAADVKNKWENSSWGRKLIVQKRRASLNDFDRFKIMLAKIKRGGVI 207

HSP 2
Score: 54.6842 bits (130), Expect = 6.72441e-44
Identity = 28/43 (65.12%), Postives = 32/43 (74.42%), Query Frame = 2
Query:    2 SSFPLSPQFASPSSSQTKMPFKRYVEIGRVALVNYGKEYGRLV 130
S FPL + S + MPFKRYVE+GRVALVNYGK+YGRLV
Sbjct: 73 SIFPLP----AVSRALANMPFKRYVEVGRVALVNYGKDYGRLV 111

HSP 3
Score: 23.483 bits (49), Expect = 6.72441e-44
Identity = 12/23 (52.17%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  111 RNMGDSSXIVAVIDXNRALVGCP 179
++ G IV VID NRALV P
Sbjct: 105 KDYGRLVVIVDVIDQNRALVDAP 127

C5YC29_SORBI1.03e-4183.13%
Putative uncharacterized protein Sb06g02...
HSP 1
Score: 139.043 bits (349), Expect = 1.02549e-41
Identity = 69/83 (83.13%), Postives = 71/83 (85.54%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM RC MNFKRLSLTDI IDIKR PKK TLI AME ADVK KWENSSWG KLIV KRRA+LNDFDR K+MLAKIKRGG I
Sbjct: 39 DAPDMVRCQMNFKRLSLTDIKIDIKRVPKKTTLIKAMEEADVKTKWENSSWGKKLIVQKRRASLNDFDRFKIMLAKIKRGGAI 121

HSP 2
Score: 53.1434 bits (126), Expect = 1.02549e-41
Identity = 24/25 (96.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKR+VEIGRVALVNYGKEYGRLV
Sbjct: 1 MPFKRFVEIGRVALVNYGKEYGRLV 25

HSP 3
Score: 22.7126 bits (47), Expect = 1.02549e-41
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV V+D NRALV P
Sbjct: 27 IVDVVDQNRALVDAP 41

B4FC17_MAIZE1.03e-4183.13%
Putative uncharacterized protein OS=Zea ...
HSP 1
Score: 139.043 bits (349), Expect = 1.02549e-41
Identity = 69/83 (83.13%), Postives = 72/83 (86.75%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM RC MNFKRLSLTDI IDIKR PKK TLI AME ADVK+KWENSSWG KLIV KRRA+LNDFDR K+MLAKIKRGG I
Sbjct: 39 DAPDMVRCQMNFKRLSLTDIKIDIKRVPKKTTLIKAMEEADVKSKWENSSWGKKLIVQKRRASLNDFDRFKVMLAKIKRGGAI 121

HSP 2
Score: 53.1434 bits (126), Expect = 1.02549e-41
Identity = 24/25 (96.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKR+VEIGRVALVNYGKEYGRLV
Sbjct: 1 MPFKRFVEIGRVALVNYGKEYGRLV 25

HSP 3
Score: 22.7126 bits (47), Expect = 1.02549e-41
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV V+D NRALV P
Sbjct: 27 IVDVVDQNRALVDAP 41

Q7X752_ORYSJ1.34e-4183.13%
OSJNBb0070J16.13 protein OS=Oryza sativa...
HSP 1
Score: 139.428 bits (350), Expect = 1.33567e-41
Identity = 69/83 (83.13%), Postives = 72/83 (86.75%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM RC +NFKRLSLTDI IDIKR PKK TLI AME ADVKNKWENSSWG KLIV KRRA+LNDFDR K+MLAKIKRGG I
Sbjct: 39 DAPDMVRCQINFKRLSLTDIKIDIKRVPKKTTLIKAMEEADVKNKWENSSWGKKLIVQKRRASLNDFDRFKVMLAKIKRGGAI 121

HSP 2
Score: 51.9878 bits (123), Expect = 1.33567e-41
Identity = 23/25 (92.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKR+VEIGRVALVNYGK+YGRLV
Sbjct: 1 MPFKRFVEIGRVALVNYGKDYGRLV 25

HSP 3
Score: 23.0978 bits (48), Expect = 1.33567e-41
Identity = 11/23 (47.83%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  111 RNMGDSSXIVAVIDXNRALVGCP 179
++ G IV V+D NRALV P
Sbjct: 19 KDYGRLVVIVDVVDQNRALVDAP 41

Q6K1Q6_ORYSJ1.34e-4183.13%
Putative hydroxyproline-rich glycoprotei...
HSP 1
Score: 139.428 bits (350), Expect = 1.33567e-41
Identity = 69/83 (83.13%), Postives = 72/83 (86.75%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM RC +NFKRLSLTDI IDIKR PKK TLI AME ADVKNKWENSSWG KLIV KRRA+LNDFDR K+MLAKIKRGG I
Sbjct: 39 DAPDMVRCQINFKRLSLTDIKIDIKRVPKKTTLIKAMEEADVKNKWENSSWGKKLIVQKRRASLNDFDRFKVMLAKIKRGGAI 121

HSP 2
Score: 51.9878 bits (123), Expect = 1.33567e-41
Identity = 23/25 (92.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKR+VEIGRVALVNYGK+YGRLV
Sbjct: 1 MPFKRFVEIGRVALVNYGKDYGRLV 25

HSP 3
Score: 23.0978 bits (48), Expect = 1.33567e-41
Identity = 11/23 (47.83%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  111 RNMGDSSXIVAVIDXNRALVGCP 179
++ G IV V+D NRALV P
Sbjct: 19 KDYGRLVVIVDVVDQNRALVDAP 41

Q01I11_ORYSA1.34e-4183.13%
OSIGBa0140J09.10 protein OS=Oryza sativa...
HSP 1
Score: 139.428 bits (350), Expect = 1.33567e-41
Identity = 69/83 (83.13%), Postives = 72/83 (86.75%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM RC +NFKRLSLTDI IDIKR PKK TLI AME ADVKNKWENSSWG KLIV KRRA+LNDFDR K+MLAKIKRGG I
Sbjct: 39 DAPDMVRCQINFKRLSLTDIKIDIKRVPKKTTLIKAMEEADVKNKWENSSWGKKLIVQKRRASLNDFDRFKVMLAKIKRGGAI 121

HSP 2
Score: 51.9878 bits (123), Expect = 1.33567e-41
Identity = 23/25 (92.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKR+VEIGRVALVNYGK+YGRLV
Sbjct: 1 MPFKRFVEIGRVALVNYGKDYGRLV 25

HSP 3
Score: 23.0978 bits (48), Expect = 1.33567e-41
Identity = 11/23 (47.83%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  111 RNMGDSSXIVAVIDXNRALVGCP 179
++ G IV V+D NRALV P
Sbjct: 19 KDYGRLVVIVDVVDQNRALVDAP 41

B8AS12_ORYSI1.34e-4183.13%
Putative uncharacterized protein OS=Oryz...
HSP 1
Score: 139.428 bits (350), Expect = 1.33567e-41
Identity = 69/83 (83.13%), Postives = 72/83 (86.75%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM RC +NFKRLSLTDI IDIKR PKK TLI AME ADVKNKWENSSWG KLIV KRRA+LNDFDR K+MLAKIKRGG I
Sbjct: 39 DAPDMVRCQINFKRLSLTDIKIDIKRVPKKTTLIKAMEEADVKNKWENSSWGKKLIVQKRRASLNDFDRFKVMLAKIKRGGAI 121

HSP 2
Score: 51.9878 bits (123), Expect = 1.33567e-41
Identity = 23/25 (92.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKR+VEIGRVALVNYGK+YGRLV
Sbjct: 1 MPFKRFVEIGRVALVNYGKDYGRLV 25

HSP 3
Score: 23.0978 bits (48), Expect = 1.33567e-41
Identity = 11/23 (47.83%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  111 RNMGDSSXIVAVIDXNRALVGCP 179
++ G IV V+D NRALV P
Sbjct: 19 KDYGRLVVIVDVVDQNRALVDAP 41

A2X7C9_ORYSI1.34e-4183.13%
Putative uncharacterized protein OS=Oryz...
HSP 1
Score: 139.428 bits (350), Expect = 1.33567e-41
Identity = 69/83 (83.13%), Postives = 72/83 (86.75%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM RC +NFKRLSLTDI IDIKR PKK TLI AME ADVKNKWENSSWG KLIV KRRA+LNDFDR K+MLAKIKRGG I
Sbjct: 39 DAPDMVRCQINFKRLSLTDIKIDIKRVPKKTTLIKAMEEADVKNKWENSSWGKKLIVQKRRASLNDFDRFKVMLAKIKRGGAI 121

HSP 2
Score: 51.9878 bits (123), Expect = 1.33567e-41
Identity = 23/25 (92.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKR+VEIGRVALVNYGK+YGRLV
Sbjct: 1 MPFKRFVEIGRVALVNYGKDYGRLV 25

HSP 3
Score: 23.0978 bits (48), Expect = 1.33567e-41
Identity = 11/23 (47.83%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  111 RNMGDSSXIVAVIDXNRALVGCP 179
++ G IV V+D NRALV P
Sbjct: 19 KDYGRLVVIVDVVDQNRALVDAP 41

B9SV21_RICCO1.34e-4183.13%
60S ribosomal protein L14, putative OS=R...
HSP 1
Score: 138.272 bits (347), Expect = 1.33792e-41
Identity = 69/83 (83.13%), Postives = 72/83 (86.75%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM R MNFKRL+LTDI IDIKR P+KKTLI AME ADVKNKWENSSWG KLIV KRRA+LNDFDR KLMLAKIKRGG I
Sbjct: 39 DAPDMVRSQMNFKRLTLTDIKIDIKRVPRKKTLIEAMENADVKNKWENSSWGRKLIVQKRRASLNDFDRFKLMLAKIKRGGFI 121

HSP 2
Score: 52.373 bits (124), Expect = 1.33792e-41
Identity = 23/25 (92.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
MPFKRYVEIGRVALVNYGK+YG+LV
Sbjct: 1 MPFKRYVEIGRVALVNYGKDYGKLV 25

HSP 3
Score: 23.8682 bits (50), Expect = 1.33792e-41
Identity = 12/23 (52.17%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  111 RNMGDSSXIVAVIDXNRALVGCP 179
++ G IV VID NRALV P
Sbjct: 19 KDYGKLVVIVDVIDQNRALVDAP 41

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: Vaccinium_corymbosum_v1_Contig710
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010128760011.02e-4785.54%GSVIVT01012876001 assembled CDS
HSP 1
Score: 144.436 bits (363), Expect = 1.02452e-47
Identity = 71/83 (85.54%), Postives = 74/83 (89.16%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM RC MNFKRLSLTDI IDIKR PKKKTLI AM AADVKNKWENSSWG KLIV KRRA+LNDFDR K+MLAKIKRGG+I
Sbjct: 84 DAPDMVRCQMNFKRLSLTDIKIDIKRVPKKKTLIEAMNAADVKNKWENSSWGRKLIVQKRRASLNDFDRFKIMLAKIKRGGVI 166

HSP 2
Score: 60.077 bits (144), Expect = 1.02452e-47
Identity = 28/31 (90.32%), Postives = 29/31 (93.55%), Query Frame = 2
Query:   38 SSSQTKMPFKRYVEIGRVALVNYGKEYGRLV 130
S +Q KMPFKRYVEIGRVALVNYGKEYGRLV
Sbjct: 40 SHAQAKMPFKRYVEIGRVALVNYGKEYGRLV 70

HSP 3
Score: 23.0978 bits (48), Expect = 1.02452e-47
Identity = 11/15 (73.33%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV VID NRALV P
Sbjct: 72 IVDVIDQNRALVDAP 86

GSVIVT010278440014.04e-4685.54%GSVIVT01027844001 assembled CDS
HSP 1
Score: 144.05 bits (362), Expect = 4.03916e-46
Identity = 71/83 (85.54%), Postives = 74/83 (89.16%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM RC MNFKRLSLTDI IDIKR PKKKTLI AM AADVKNKWENSSWG KLIV KRRA+LNDFDR K+MLAKIKRGG+I
Sbjct: 125 DAPDMVRCQMNFKRLSLTDIKIDIKRVPKKKTLIEAMTAADVKNKWENSSWGRKLIVQKRRASLNDFDRFKIMLAKIKRGGVI 207

HSP 2
Score: 54.6842 bits (130), Expect = 4.03916e-46
Identity = 28/43 (65.12%), Postives = 32/43 (74.42%), Query Frame = 2
Query:    2 SSFPLSPQFASPSSSQTKMPFKRYVEIGRVALVNYGKEYGRLV 130
S FPL + S + MPFKRYVE+GRVALVNYGK+YGRLV
Sbjct: 73 SIFPLP----AVSRALANMPFKRYVEVGRVALVNYGKDYGRLV 111

HSP 3
Score: 23.483 bits (49), Expect = 4.03916e-46
Identity = 12/23 (52.17%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  111 RNMGDSSXIVAVIDXNRALVGCP 179
++ G IV VID NRALV P
Sbjct: 105 KDYGRLVVIVDVIDQNRALVDAP 127

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: Vaccinium_corymbosum_v1_Contig710
Best 10 Hits Shown

Match Name E value Identity Description
AT2G20450.1 2.39e-3978.31%
Ribosomal protein L14 | chr2:8813923-88...
HSP 1
Score: 131.339 bits (329), Expect = 2.39447e-39
Identity = 65/83 (78.31%), Postives = 68/83 (81.93%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM R MN KRLSLTDI IDI R PKKK LI AME ADVKNKWE SSWG KLIV KRRAALNDFDR K+MLAKIKR G++
Sbjct: 39 DAPDMERIQMNLKRLSLTDIVIDINRVPKKKVLIEAMEKADVKNKWEKSSWGRKLIVQKRRAALNDFDRFKIMLAKIKRAGIV 121

HSP 2
Score: 45.8246 bits (107), Expect = 2.39447e-39
Identity = 20/25 (80.00%), Postives = 24/25 (96.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
M FKR+VEIGRVALVNYG++YG+LV
Sbjct: 1 MGFKRFVEIGRVALVNYGEDYGKLV 25

HSP 3
Score: 22.7126 bits (47), Expect = 2.39447e-39
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV V+D NRALV P
Sbjct: 27 IVDVVDQNRALVDAP 41

AT4G27090.1 8.89e-3977.11%
Ribosomal protein L14 | chr4:13594104-1...
HSP 1
Score: 129.798 bits (325), Expect = 8.88548e-39
Identity = 64/83 (77.11%), Postives = 68/83 (81.93%), Query Frame = 1
Query:  172 DAPDMXRCXMNFKRLSLTDITIDIKRAPKKKTLIAAMEAADVKNKWENSSWGIKLIVHKRRAALNDFDRXKLMLAKIKRGGLI 420
DAPDM R MNFKRLSLTDI IDI R PKKK LI AME ADVKNKWE SSWG KLIV KRRA LNDFDR K+MLAKIK+ G++
Sbjct: 39 DAPDMERIQMNFKRLSLTDIVIDINRVPKKKALIEAMEKADVKNKWEKSSWGRKLIVQKRRANLNDFDRFKIMLAKIKKAGVV 121

HSP 2
Score: 45.4394 bits (106), Expect = 8.88548e-39
Identity = 20/25 (80.00%), Postives = 24/25 (96.00%), Query Frame = 2
Query:   56 MPFKRYVEIGRVALVNYGKEYGRLV 130
M FKRYVEIGRVALVNYG+++G+LV
Sbjct: 1 MGFKRYVEIGRVALVNYGEDHGKLV 25

HSP 3
Score: 22.7126 bits (47), Expect = 8.88548e-39
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  135 IVAVIDXNRALVGCP 179
IV V+D NRALV P
Sbjct: 27 IVDVVDQNRALVDAP 41

Related info for Vaccinium_corymbosum_v1_Contig710