CV191201

Information for CV191201

NameCV191201
AccessionID557
Length188 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_016374 Vco01
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CV191201
Sequence
GACCAAAGAGCGTGTTGTGACGTTAGAGGCAGTCTCTTGTTCCACAGACAACTAGGGTTG
CGATGGAGACGATCAATCTCAAGTTCGTCGACACATCTTCCAAGTTTGGACATGGTCGAT
TCCAGACATCAGGGGAGAAGGGCAAGTTCTATGGACGGCTCAAAGCTGAAACCACCAAGA
CTACATAA
Download sequence in fasta format

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CV191201_1_ORF1 CRC64: 8BB7C94374B22402 LENGTH: 62 aa
noIPR
unintegrated
unintegrated
seg [18-36]? NA seg seg seg
SEQUENCE: CV191201_3_ORF2 CRC64: A472C6E8E58D566F LENGTH: 53 aa
noIPR
unintegrated
unintegrated
PTHR11363 [1-51]T 5.7e-20 PTHR11363 RIBOSOMAL PROTEIN L3P RIBOSOMAL PROTEIN L3P

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CV191201
Best 10 Hits Shown

Match Name E value Identity Description
ppa006946m 1.21e-1569.09%ppa006946m
HSP 1
Score: 77.7962 bits (190), Expect = 1.20616e-15
Identity = 38/55 (69.09%), Postives = 45/55 (81.82%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQSL+ QT+RVA+E I LKF+DTSSKFGHGRFQT+ EK +FYGRLKA
Sbjct: 335 PKKRVVTLRQSLLKQTSRVALEDIKLKFIDTSSKFGHGRFQTTQEKARFYGRLKA 389

ppa006941m 4.58e-1567.27%ppa006941m
HSP 1
Score: 75.8702 bits (185), Expect = 4.58342e-15
Identity = 37/55 (67.27%), Postives = 45/55 (81.82%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQSL+ QT+R+A+E I LKF+DTSSKFGHGRFQT+ EK K+YGRLKA
Sbjct: 335 PKKRVVTLRQSLLKQTSRLALEDIKLKFIDTSSKFGHGRFQTTQEKQKYYGRLKA 389

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CV191201
Best 10 Hits Shown

Match Name E value Identity Description
RL3_ORYSJ3.70e-1363.64%
60S ribosomal protein L3 OS=Oryza sativa...
HSP 1
Score: 73.559 bits (179), Expect = 3.70309e-13
Identity = 35/55 (63.64%), Postives = 45/55 (81.82%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQSL+ QT+R+A+E I LKF+DTSSKFGHGRFQT+ EK +F+G+LKA
Sbjct: 335 PKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTDEKQRFFGKLKA 389

RL3_CAEEL4.53e-1160.71%
60S ribosomal protein L3 OS=Caenorhabdit...
HSP 1
Score: 66.6254 bits (161), Expect = 4.52671e-11
Identity = 34/56 (60.71%), Postives = 41/56 (73.21%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKAE 170
PK L R+SL+ QT RVA E INLK++DTSSK GHGRFQT+ EK F G+LK +
Sbjct: 337 PKKRLITLRKSLITQTKRVAHEKINLKWIDTSSKTGHGRFQTTAEKRAFMGKLKRD 392

RL3_CAEBR4.53e-1160.71%
60S ribosomal protein L3 OS=Caenorhabdit...
HSP 1
Score: 66.6254 bits (161), Expect = 4.52671e-11
Identity = 34/56 (60.71%), Postives = 41/56 (73.21%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKAE 170
PK L R+SL+ QT RVA E INLK++DTSSK GHGRFQT+ EK F G+LK +
Sbjct: 337 PKKRLITLRKSLITQTKRVAHEKINLKWIDTSSKTGHGRFQTTAEKRAFMGKLKRD 392

RL32_ARATH1.01e-1061.54%
60S ribosomal protein L3-2 OS=Arabidopsi...
HSP 1
Score: 65.4698 bits (158), Expect = 1.00845e-10
Identity = 32/52 (61.54%), Postives = 39/52 (75.00%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGR 158
PK + RQ+L+ QT+R+AME I LKF+D +S GHGRFQTS EK KFYGR
Sbjct: 335 PKKRVVTLRQTLLKQTSRLAMEEIKLKFIDAASNGGHGRFQTSQEKAKFYGR 386

RL3_TOXCA1.32e-1064.58%
60S ribosomal protein L3 OS=Toxocara can...
HSP 1
Score: 65.0846 bits (157), Expect = 1.31707e-10
Identity = 31/48 (64.58%), Postives = 37/48 (77.08%), Query Frame = 3
Query:   27 RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKAE 170
R+SL+ QT R A E INLK++DTSSKFGHGRFQT EK F G+LK +
Sbjct: 345 RKSLIVQTKRFAHEKINLKWIDTSSKFGHGRFQTHAEKRAFMGKLKKD 392

RL31_ARATH1.72e-1060.38%
60S ribosomal protein L3-1 OS=Arabidopsi...
HSP 1
Score: 64.6994 bits (156), Expect = 1.72015e-10
Identity = 32/53 (60.38%), Postives = 41/53 (77.36%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRL 161
PK + RQSL+ QT+R+A+E I LKF+DT+S FGHGRFQTS EK +FY R+
Sbjct: 335 PKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYNRV 387

RL3_RAT1.46e-0962.50%
60S ribosomal protein L3 OS=Rattus norve...
HSP 1
Score: 61.6178 bits (148), Expect = 1.45619e-09
Identity = 30/48 (62.50%), Postives = 37/48 (77.08%), Query Frame = 3
Query:   27 RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKAE 170
R+SL+ QT R A+E I+LKF+DT+SKFGHGRFQT EK F G LK +
Sbjct: 348 RKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKD 395

RL3_MOUSE1.46e-0962.50%
60S ribosomal protein L3 OS=Mus musculus...
HSP 1
Score: 61.6178 bits (148), Expect = 1.45619e-09
Identity = 30/48 (62.50%), Postives = 37/48 (77.08%), Query Frame = 3
Query:   27 RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKAE 170
R+SL+ QT R A+E I+LKF+DT+SKFGHGRFQT EK F G LK +
Sbjct: 348 RKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKD 395

RL3_MACFA1.46e-0962.50%
60S ribosomal protein L3 OS=Macaca fasci...
HSP 1
Score: 61.6178 bits (148), Expect = 1.45619e-09
Identity = 30/48 (62.50%), Postives = 37/48 (77.08%), Query Frame = 3
Query:   27 RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKAE 170
R+SL+ QT R A+E I+LKF+DT+SKFGHGRFQT EK F G LK +
Sbjct: 348 RKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKD 395

RL3_HUMAN1.46e-0962.50%
60S ribosomal protein L3 OS=Homo sapiens...
HSP 1
Score: 61.6178 bits (148), Expect = 1.45619e-09
Identity = 30/48 (62.50%), Postives = 37/48 (77.08%), Query Frame = 3
Query:   27 RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKAE 170
R+SL+ QT R A+E I+LKF+DT+SKFGHGRFQT EK F G LK +
Sbjct: 348 RKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKD 395

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CV191201
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0022s006701.04e-1572.22%POPTR_0022s00670.2
HSP 1
Score: 78.5666 bits (192), Expect = 1.04139e-15
Identity = 39/54 (72.22%), Postives = 44/54 (81.48%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLK 164
PK + RQSL+ QT+RVAME I LKF+DTSSKFGHGRFQT+ EK KFYGRLK
Sbjct: 304 PKKRVVTLRQSLLKQTSRVAMEEIKLKFIDTSSKFGHGRFQTTEEKAKFYGRLK 357

POPTR_0022s006701.04e-1572.22%POPTR_0022s00670.1
HSP 1
Score: 78.5666 bits (192), Expect = 1.04139e-15
Identity = 39/54 (72.22%), Postives = 44/54 (81.48%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLK 164
PK + RQSL+ QT+RVAME I LKF+DTSSKFGHGRFQT+ EK KFYGRLK
Sbjct: 335 PKKRVVTLRQSLLKQTSRVAMEEIKLKFIDTSSKFGHGRFQTTEEKAKFYGRLK 388

POPTR_0005s216402.32e-1570.91%POPTR_0005s21640.1
HSP 1
Score: 77.411 bits (189), Expect = 2.31997e-15
Identity = 39/55 (70.91%), Postives = 45/55 (81.82%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQSL+ QT+R+A+E I LKFVDTSSKFGHGRFQT+ EK KFYGRLKA
Sbjct: 335 PKKRVVTLRQSLLKQTSRLALEEIKLKFVDTSSKFGHGRFQTTQEKQKFYGRLKA 389

POPTR_0002s066801.50e-1469.09%POPTR_0002s06680.1
HSP 1
Score: 74.7146 bits (182), Expect = 1.50376e-14
Identity = 38/55 (69.09%), Postives = 44/55 (80.00%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQ+L+ QT+R+A E I LKFVDTSSKFGHGRFQT+ EK KFYGRLKA
Sbjct: 335 PKKRVVTLRQTLLKQTSRLAHEEIKLKFVDTSSKFGHGRFQTTQEKQKFYGRLKA 389

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CV191201
Best 10 Hits Shown

Match Name E value Identity Description
B9SKD1_RICCO1.78e-1370.91%
60S ribosomal protein L3, putative OS=Ri...
HSP 1
Score: 78.9518 bits (193), Expect = 1.78349e-13
Identity = 39/55 (70.91%), Postives = 45/55 (81.82%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQSL+ QT+RVAME I +KF+DTSSKFGHGRFQT+ EK KFYGRLKA
Sbjct: 335 PKKRVVTLRQSLLNQTSRVAMEEIKIKFIDTSSKFGHGRFQTAQEKAKFYGRLKA 389

D7TGS9_VITVI2.33e-1370.91%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 78.5666 bits (192), Expect = 2.32931e-13
Identity = 39/55 (70.91%), Postives = 45/55 (81.82%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQSL+ QT+RVAME I LKF+DTSSKFGHGRFQT+ EK KF+GRLKA
Sbjct: 335 PKKRVVTLRQSLLKQTSRVAMEEIKLKFIDTSSKFGHGRFQTTQEKAKFFGRLKA 389

B9NF32_POPTR2.33e-1372.22%
Predicted protein (Fragment) OS=Populus ...
HSP 1
Score: 78.5666 bits (192), Expect = 2.32931e-13
Identity = 39/54 (72.22%), Postives = 44/54 (81.48%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLK 164
PK + RQSL+ QT+RVAME I LKF+DTSSKFGHGRFQT+ EK KFYGRLK
Sbjct: 98 PKKRVVTLRQSLLKQTSRVAMEEIKLKFIDTSSKFGHGRFQTTEEKAKFYGRLK 151

B9N769_POPTR2.33e-1372.22%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 78.5666 bits (192), Expect = 2.32931e-13
Identity = 39/54 (72.22%), Postives = 44/54 (81.48%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLK 164
PK + RQSL+ QT+RVAME I LKF+DTSSKFGHGRFQT+ EK KFYGRLK
Sbjct: 335 PKKRVVTLRQSLLKQTSRVAMEEIKLKFIDTSSKFGHGRFQTTEEKAKFYGRLK 388

A9PCQ3_POPTR2.33e-1372.22%
Putative uncharacterized protein OS=Popu...
HSP 1
Score: 78.5666 bits (192), Expect = 2.32931e-13
Identity = 39/54 (72.22%), Postives = 44/54 (81.48%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLK 164
PK + RQSL+ QT+RVAME I LKF+DTSSKFGHGRFQT+ EK KFYGRLK
Sbjct: 335 PKKRVVTLRQSLLKQTSRVAMEEIKLKFIDTSSKFGHGRFQTTEEKAKFYGRLK 388

A5BAZ0_VITVI2.33e-1370.91%
Putative uncharacterized protein OS=Viti...
HSP 1
Score: 78.5666 bits (192), Expect = 2.32931e-13
Identity = 39/55 (70.91%), Postives = 45/55 (81.82%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQSL+ QT+RVAME I LKF+DTSSKFGHGRFQT+ EK KF+GRLKA
Sbjct: 335 PKKRVVTLRQSLLKQTSRVAMEEIKLKFIDTSSKFGHGRFQTTQEKAKFFGRLKA 389

Q6TKQ9_TOBAC3.04e-1370.91%
Ribosomal protein L3B OS=Nicotiana tabac...
HSP 1
Score: 78.1814 bits (191), Expect = 3.04217e-13
Identity = 39/55 (70.91%), Postives = 45/55 (81.82%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQSL+ QT+RVA+E I LKF+DTSSKFGHGRFQT+ EK KFYGRLKA
Sbjct: 355 PKKRVVTLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKDKFYGRLKA 409

B9SE83_RICCO3.04e-1370.91%
60S ribosomal protein L3, putative OS=Ri...
HSP 1
Score: 78.1814 bits (191), Expect = 3.04217e-13
Identity = 39/55 (70.91%), Postives = 45/55 (81.82%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQSL+ QT+RVA+E I LKF+DTSSKFGHGRFQT+ EK KFYGRLKA
Sbjct: 335 PKKRVVTLRQSLLKQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFYGRLKA 389

Q2VCJ2_SOLTU3.97e-1370.91%
Ribosomal protein L3-like OS=Solanum tub...
HSP 1
Score: 77.7962 bits (190), Expect = 3.97319e-13
Identity = 39/55 (70.91%), Postives = 45/55 (81.82%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQSL+ QT+RVA+E I LKF+DTSSKFGHGRFQT+ EK KFYGRLKA
Sbjct: 335 PKKRVVTLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFYGRLKA 389

Q7X744_WHEAT5.19e-1369.09%
Ribosomal protein L3 OS=Triticum aestivu...
HSP 1
Score: 77.411 bits (189), Expect = 5.18915e-13
Identity = 38/55 (69.09%), Postives = 45/55 (81.82%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQSL+ QT+R+A+E I LKF+DTSSKFGHGRFQT+ EK KFYGRLKA
Sbjct: 335 PKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTDEKQKFYGRLKA 389

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CV191201
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010232410016.06e-1670.91%GSVIVT01023241001 assembled CDS
HSP 1
Score: 78.5666 bits (192), Expect = 6.05755e-16
Identity = 39/55 (70.91%), Postives = 45/55 (81.82%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQSL+ QT+RVAME I LKF+DTSSKFGHGRFQT+ EK KF+GRLKA
Sbjct: 335 PKKRVVTLRQSLLKQTSRVAMEEIKLKFIDTSSKFGHGRFQTTQEKAKFFGRLKA 389

GSVIVT010345550011.35e-1569.09%GSVIVT01034555001 assembled CDS
HSP 1
Score: 77.411 bits (189), Expect = 1.34948e-15
Identity = 38/55 (69.09%), Postives = 45/55 (81.82%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQSL+ QT+RVA+E I LKF+DTSSKFGHGRFQT+ EK KFYGR+KA
Sbjct: 395 PKKRVVTLRQSLLKQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFYGRMKA 449

GSVIVT010222840018.75e-1567.27%GSVIVT01022284001 assembled CDS
HSP 1
Score: 74.7146 bits (182), Expect = 8.74709e-15
Identity = 37/55 (67.27%), Postives = 44/55 (80.00%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRLKA 167
PK + RQSL+ QT+RVA+E I LKF+DT+SKFGHGRF T+ EK KFYGRLKA
Sbjct: 44 PKKRVVTLRQSLLKQTSRVALEEIKLKFIDTASKFGHGRFPTTQEKQKFYGRLKA 98

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CV191201
Best 10 Hits Shown

Match Name E value Identity Description
AT1G61580.1 7.78e-1261.54%
R-protein L3 B | chr1:22720833-22722402...
HSP 1
Score: 65.4698 bits (158), Expect = 7.77658e-12
Identity = 32/52 (61.54%), Postives = 39/52 (75.00%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGR 158
PK + RQ+L+ QT+R+AME I LKF+D +S GHGRFQTS EK KFYGR
Sbjct: 335 PKKRVVTLRQTLLKQTSRLAMEEIKLKFIDAASNGGHGRFQTSQEKAKFYGR 386

AT1G43170.8 1.33e-1160.38%
ribosomal protein 1 | chr1:16266992-162...
HSP 1
Score: 64.6994 bits (156), Expect = 1.32648e-11
Identity = 32/53 (60.38%), Postives = 41/53 (77.36%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRL 161
PK + RQSL+ QT+R+A+E I LKF+DT+S FGHGRFQTS EK +FY R+
Sbjct: 335 PKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYNRV 387

AT1G43170.9 1.33e-1160.38%
ribosomal protein 1 | chr1:16266992-162...
HSP 1
Score: 64.6994 bits (156), Expect = 1.32648e-11
Identity = 32/53 (60.38%), Postives = 41/53 (77.36%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRL 161
PK + RQSL+ QT+R+A+E I LKF+DT+S FGHGRFQTS EK +FY R+
Sbjct: 335 PKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYNRV 387

AT1G43170.7 1.33e-1160.38%
ribosomal protein 1 | chr1:16266992-162...
HSP 1
Score: 64.6994 bits (156), Expect = 1.32648e-11
Identity = 32/53 (60.38%), Postives = 41/53 (77.36%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRL 161
PK + RQSL+ QT+R+A+E I LKF+DT+S FGHGRFQTS EK +FY R+
Sbjct: 335 PKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYNRV 387

AT1G43170.6 1.33e-1160.38%
ribosomal protein 1 | chr1:16266992-162...
HSP 1
Score: 64.6994 bits (156), Expect = 1.32648e-11
Identity = 32/53 (60.38%), Postives = 41/53 (77.36%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRL 161
PK + RQSL+ QT+R+A+E I LKF+DT+S FGHGRFQTS EK +FY R+
Sbjct: 335 PKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYNRV 387

AT1G43170.5 1.33e-1160.38%
ribosomal protein 1 | chr1:16266992-162...
HSP 1
Score: 64.6994 bits (156), Expect = 1.32648e-11
Identity = 32/53 (60.38%), Postives = 41/53 (77.36%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRL 161
PK + RQSL+ QT+R+A+E I LKF+DT+S FGHGRFQTS EK +FY R+
Sbjct: 335 PKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYNRV 387

AT1G43170.4 1.33e-1160.38%
ribosomal protein 1 | chr1:16267519-162...
HSP 1
Score: 64.6994 bits (156), Expect = 1.32648e-11
Identity = 32/53 (60.38%), Postives = 41/53 (77.36%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRL 161
PK + RQSL+ QT+R+A+E I LKF+DT+S FGHGRFQTS EK +FY R+
Sbjct: 252 PKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYNRV 304

AT1G43170.3 1.33e-1160.38%
ribosomal protein 1 | chr1:16266992-162...
HSP 1
Score: 64.6994 bits (156), Expect = 1.32648e-11
Identity = 32/53 (60.38%), Postives = 41/53 (77.36%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRL 161
PK + RQSL+ QT+R+A+E I LKF+DT+S FGHGRFQTS EK +FY R+
Sbjct: 335 PKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYNRV 387

AT1G43170.2 1.33e-1160.38%
ribosomal protein 1 | chr1:16266992-162...
HSP 1
Score: 64.6994 bits (156), Expect = 1.32648e-11
Identity = 32/53 (60.38%), Postives = 41/53 (77.36%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRL 161
PK + RQSL+ QT+R+A+E I LKF+DT+S FGHGRFQTS EK +FY R+
Sbjct: 335 PKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYNRV 387

AT1G43170.1 1.33e-1160.38%
ribosomal protein 1 | chr1:16266992-162...
HSP 1
Score: 64.6994 bits (156), Expect = 1.32648e-11
Identity = 32/53 (60.38%), Postives = 41/53 (77.36%), Query Frame = 3
Query:    3 PKSVL*R*RQSLVPQTTRVAMETINLKFVDTSSKFGHGRFQTSGEKGKFYGRL 161
PK + RQSL+ QT+R+A+E I LKF+DT+S FGHGRFQTS EK +FY R+
Sbjct: 335 PKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYNRV 387

Related info for CV191201