DW043524

Information for DW043524

NameDW043524
AccessionID710
Length538 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_018810 Subtracted cDNA library of Vaccinium corymbosum
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession DW043524
Sequence
GCTTACCTGGACAGCCATGTACAGGAAGCAACATAAGAAGGACATTGCTCAAGAAGCTGT
CAAGAAGAGGCGTCGCACTACCAAGAAGCCTTACTCGAGGTCTATTGTAGGTGCTACTTT
GGAGGTTATACAGAAGAAAAGGACTGAAAAGCCTGAAGTTCGTGACGCTGCAAGGGAGGC
AGCCCTCCGTGAAATTAAAGGAGAGGATTAAGAAAACAAAGGATGAAAAGAAGGCGAAGA
AAGCTGAGGTGACTGCTAAGACCCAGAAGGCAGGCAAAGGTAACATATCCAAGGGTGCTG
CACCTAAGGGCCCCAAGCTTGGAGGTGGTGGTGGACAAGCGTTGAAAAGCCTTATTGTCT
CCTCCATTTCTCTTCCTGGTAAAAAAGAAAGCCTTAAAAAACCATTTGGTTTGAAGGGGT
ATTTGGTAATGTGGCCTGGGTTCCTTTCCGCTACAACTTAGTGGTTTATTGCCTTTGAAC
CCAAATTCTAATTGGTCCCGAAAACAAAAAAATCCACCGCCCCCCCATATTTTTTTTT
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0006412 biological_process translation
GO:0005622 cellular_component intracellular
GO:0005840 cellular_component ribosome
GO:0003735 molecular_function structural constituent of ribosome

KEGG Analysis

Analysis Date: 01-18-2011 (KEGG analysis for Vaccinium corymbosum unigene v1)
K02896 RP-L24e, RPL24; large subunit ribosomal protein L24e

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: DW043524_2_ORF1 CRC64: 36A6EC599646E8A2 LENGTH: 69 aa
InterPro
IPR000988
Family
Ribosomal protein L24e
PTHR10792 [1-66]T 2e-27 PTHR10792 60S RIBOSOMAL PROTEIN L24 60S RIBOSOMAL PROTEIN L24
PF01246 [1-23]T 2.7e-06 PF01246 Ribosomal_L24e Ribosomal_L24e
noIPR
unintegrated
unintegrated
PTHR10792:SF1 [1-66]T 2e-27 PTHR10792:SF1 60S RIBOSOMAL PROTEIN L24 60S RIBOSOMAL PROTEIN L24
SEQUENCE: DW043524_3_ORF2 CRC64: 9D81D6A7E0323B2D LENGTH: 116 aa
noIPR
unintegrated
unintegrated
seg [28-53]? NA seg seg[61-79]? NA seg seg seg
SEQUENCE: DW043524_5_ORF2 CRC64: 89116DCE0531314F LENGTH: 152 aa
noIPR
unintegrated
unintegrated
seg [42-56]? NA seg seg[66-89]? NA seg seg seg
SEQUENCE: DW043524_6_ORF1 CRC64: F0D41DAB8F509ED6 LENGTH: 113 aa
noIPR
unintegrated
unintegrated
seg [90-113]? NA seg seg seg

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: DW043524
Best 10 Hits Shown

Match Name E value Identity Description
ppa012859m 2.34e-2998.41%ppa012859m
HSP 1
Score: 124.79 bits (312), Expect = 2.34267e-29
Identity = 62/63 (98.41%), Postives = 63/63 (100.00%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQK+RTEKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAALR 113

ppa012563m 2.34e-2998.41%ppa012563m
HSP 1
Score: 124.79 bits (312), Expect = 2.34267e-29
Identity = 62/63 (98.41%), Postives = 63/63 (100.00%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQK+RTEKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAALR 113

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: DW043524
Best 10 Hits Shown

Match Name E value Identity Description
RL24_PRUAV2.63e-2898.41%
60S ribosomal protein L24 OS=Prunus aviu...
HSP 1
Score: 124.79 bits (312), Expect = 2.62901e-28
Identity = 62/63 (98.41%), Postives = 63/63 (100.00%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQK+RTEKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAALR 113

RL24_CICAR4.96e-2795.24%
60S ribosomal protein L24 OS=Cicer ariet...
HSP 1
Score: 120.553 bits (301), Expect = 4.9581e-27
Identity = 60/63 (95.24%), Postives = 61/63 (96.83%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAM+RKQHKKD AQEAVKKRRR TKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR
Sbjct: 51 LTWTAMFRKQHKKDAAQEAVKKRRRATKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 113

RL242_ARATH5.48e-2692.06%
60S ribosomal protein L24-2 OS=Arabidops...
HSP 1
Score: 117.087 bits (292), Expect = 5.48182e-26
Identity = 58/63 (92.06%), Postives = 59/63 (93.65%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
L WTAMYRKQHKKD AQEAVK+RRR TKKPYSRSIVGATLEVIQKKR EKPEVRDAAREAALR
Sbjct: 51 LAWTAMYRKQHKKDAAQEAVKRRRRATKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALR 113

RL241_ARATH7.16e-2692.06%
60S ribosomal protein L24-1 OS=Arabidops...
HSP 1
Score: 116.701 bits (291), Expect = 7.15948e-26
Identity = 58/63 (92.06%), Postives = 59/63 (93.65%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
L WTAMYRKQHKKD AQEAVK+RRR TKKPYSRSIVGATLEVIQKKR EKPEVRDAAREAALR
Sbjct: 51 LCWTAMYRKQHKKDAAQEAVKRRRRATKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALR 113

RL24_HORVU1.59e-2592.06%
60S ribosomal protein L24 OS=Hordeum vul...
HSP 1
Score: 115.546 bits (288), Expect = 1.59497e-25
Identity = 58/63 (92.06%), Postives = 58/63 (92.06%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
L WTAMYRKQHKKDI EA KKRRRTTKKPYSRSIVGATLEVIQKKR EKPEVRDAAREAALR
Sbjct: 51 LCWTAMYRKQHKKDIHAEAAKKRRRTTKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALR 113

RL24B_SCHPO9.08e-1357.14%
60S ribosomal protein L24-B OS=Schizosac...
HSP 1
Score: 73.1738 bits (178), Expect = 9.0778e-13
Identity = 36/63 (57.14%), Postives = 48/63 (76.19%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
L+WT +YR+ HKK I++E KKR R T K + R IVGA L+VI++KR ++PEVR AAR AAL+
Sbjct: 49 LSWTVLYRRMHKKGISEEHAKKRTRRTVK-HQRGIVGANLDVIKEKRNQRPEVRAAARAAALK 110

RL24A_SCHPO9.08e-1357.14%
60S ribosomal protein L24-A OS=Schizosac...
HSP 1
Score: 73.1738 bits (178), Expect = 9.0778e-13
Identity = 36/63 (57.14%), Postives = 48/63 (76.19%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
L+WT +YR+ HKK I++E KKR R T K + R IVGA L+VI++KR ++PEVR AAR AAL+
Sbjct: 49 LSWTVLYRRMHKKGISEEHAKKRTRRTVK-HQRGIVGANLDVIKEKRNQRPEVRAAARAAALK 110

RL24_NEUCR4.51e-1253.97%
60S ribosomal protein L24 OS=Neurospora ...
HSP 1
Score: 70.8626 bits (172), Expect = 4.50526e-12
Identity = 34/63 (53.97%), Postives = 48/63 (76.19%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
+ WT +YR+QHKK I++E KKR R T K R+IVGA+LEVI+++R+ +PE R AAR AA++
Sbjct: 49 IAWTVLYRRQHKKGISEEVAKKRSRRTVKA-QRAIVGASLEVIKERRSMRPEARSAARLAAIK 110

RL24_DROME6.51e-1152.38%
60S ribosomal protein L24 OS=Drosophila ...
HSP 1
Score: 67.0106 bits (162), Expect = 6.50559e-11
Identity = 33/63 (52.38%), Postives = 46/63 (73.02%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
+TWT +YR++H+K I +EA KKR R T+K + R+IVGA+L I KR KPEVR A R+ A++
Sbjct: 49 VTWTVLYRRKHRKGIEEEASKKRTRRTQK-FQRAIVGASLAEILAKRNMKPEVRKAQRDQAIK 110

RL24_DEBHA8.50e-1150.00%
60S ribosomal protein L24 OS=Debaryomyce...
HSP 1
Score: 66.6254 bits (161), Expect = 8.49656e-11
Identity = 31/62 (50.00%), Postives = 48/62 (77.42%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAAL 187
++WT +YR+QHKK I++E+ K+R R T K R+IVGA+LE+I+++R++KP R AAR+ L
Sbjct: 49 ISWTVLYRRQHKKGISEESAKRRTRKTVK-NQRAIVGASLELIKERRSQKPSDRKAARDVKL 109

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: DW043524
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0015s133302.75e-2895.24%POPTR_0015s13330.1
HSP 1
Score: 121.709 bits (304), Expect = 2.74728e-28
Identity = 60/63 (95.24%), Postives = 61/63 (96.83%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIA E +KKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAAETIKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 113

POPTR_0004s083707.99e-2895.24%POPTR_0004s08370.1
HSP 1
Score: 120.168 bits (300), Expect = 7.99336e-28
Identity = 60/63 (95.24%), Postives = 60/63 (95.24%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIA E VKKRRRTTKKPYSRSIVGATLEVIQKKR EKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAAETVKKRRRTTKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALR 113

POPTR_0012s133801.04e-2793.65%POPTR_0012s13380.1
HSP 1
Score: 119.783 bits (299), Expect = 1.04396e-27
Identity = 59/63 (93.65%), Postives = 60/63 (95.24%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIA E +KKRRR TKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAAETIKKRRRATKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 113

POPTR_0003s123301.36e-2793.65%POPTR_0003s12330.1
HSP 1
Score: 119.398 bits (298), Expect = 1.36346e-27
Identity = 59/63 (93.65%), Postives = 61/63 (96.83%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIA EAVKK+RRTTKKPYSRSIVGATLEVIQK+R EKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAAEAVKKKRRTTKKPYSRSIVGATLEVIQKRRAEKPEVRDAAREAALR 113

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: DW043524
Best 10 Hits Shown

Match Name E value Identity Description
B9SRL5_RICCO3.48e-2798.41%
60S ribosomal protein L24, putative OS=R...
HSP 1
Score: 124.79 bits (312), Expect = 3.47737e-27
Identity = 62/63 (98.41%), Postives = 63/63 (100.00%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQK+RTEKPEVRDAAREAALR
Sbjct: 73 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAALR 135

Q1SN35_MEDTR1.73e-2696.83%
Ribosomal protein L24E OS=Medicago trunc...
HSP 1
Score: 122.479 bits (306), Expect = 1.7258e-26
Identity = 61/63 (96.83%), Postives = 62/63 (98.41%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIAQEAVKKRRR TKKPYSRSIVGATLEVIQKKR+EKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAQEAVKKRRRATKKPYSRSIVGATLEVIQKKRSEKPEVRDAAREAALR 113

B7FGN9_MEDTR1.73e-2696.83%
Putative uncharacterized protein OS=Medi...
HSP 1
Score: 122.479 bits (306), Expect = 1.7258e-26
Identity = 61/63 (96.83%), Postives = 61/63 (96.83%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIAQEAVKKRRR TKKPYSRSIVG TLEVIQKKRTEKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAQEAVKKRRRATKKPYSRSIVGTTLEVIQKKRTEKPEVRDAAREAALR 113

C6SXT2_SOYBN2.25e-2696.83%
Putative uncharacterized protein OS=Glyc...
HSP 1
Score: 122.094 bits (305), Expect = 2.25396e-26
Identity = 61/63 (96.83%), Postives = 61/63 (96.83%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIAQEAVKKRRR TKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREA LR
Sbjct: 51 LTWTAMYRKQHKKDIAQEAVKKRRRATKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAQLR 113

B9ID62_POPTR2.94e-2695.24%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 121.709 bits (304), Expect = 2.94377e-26
Identity = 60/63 (95.24%), Postives = 61/63 (96.83%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIA E +KKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAAETIKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 113

B7FN60_MEDTR2.94e-2696.83%
Putative uncharacterized protein OS=Medi...
HSP 1
Score: 121.709 bits (304), Expect = 2.94377e-26
Identity = 61/63 (96.83%), Postives = 61/63 (96.83%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
L WTAMYRKQHKKDIAQEAVKKRRR TKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR
Sbjct: 51 LIWTAMYRKQHKKDIAQEAVKKRRRATKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 113

B9RC45_RICCO3.84e-2695.24%
60S ribosomal protein L24, putative OS=R...
HSP 1
Score: 121.324 bits (303), Expect = 3.84468e-26
Identity = 60/63 (95.24%), Postives = 62/63 (98.41%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIA EAVKK+RRTTKKPYSRSIVGATLEVIQK+RTEKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAAEAVKKKRRTTKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAALR 113

C6SZ00_SOYBN8.57e-2695.24%
Putative uncharacterized protein OS=Glyc...
HSP 1
Score: 120.168 bits (300), Expect = 8.56505e-26
Identity = 60/63 (95.24%), Postives = 60/63 (95.24%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIAQEAVKKRRR KKPYSRSIVGATLEVIQKKR EKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAQEAVKKRRRAAKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALR 113

B3TM46_ELAGV8.57e-2695.24%
60S ribosomal protein L24 OS=Elaeis guin...
HSP 1
Score: 120.168 bits (300), Expect = 8.56505e-26
Identity = 60/63 (95.24%), Postives = 61/63 (96.83%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDI EAVKKRRRTTKKPYSRSIVGATLEVIQK+RTEKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIHAEAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAALR 113

A9PHF8_POPTR8.57e-2695.24%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 120.168 bits (300), Expect = 8.56505e-26
Identity = 60/63 (95.24%), Postives = 60/63 (95.24%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIA E VKKRRRTTKKPYSRSIVGATLEVIQKKR EKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAAETVKKRRRTTKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALR 113

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: DW043524
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010337430016.47e-2895.24%GSVIVT01033743001 assembled CDS
HSP 1
Score: 119.783 bits (299), Expect = 6.4663e-28
Identity = 60/63 (95.24%), Postives = 61/63 (96.83%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIAQEAVKKRRR TKKPYSRSIVGATLEVIQK+RTEK EVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAQEAVKKRRRATKKPYSRSIVGATLEVIQKRRTEKAEVRDAAREAALR 113

GSVIVT010106010018.45e-2893.65%GSVIVT01010601001 assembled CDS
HSP 1
Score: 119.398 bits (298), Expect = 8.44524e-28
Identity = 59/63 (93.65%), Postives = 61/63 (96.83%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIA EAVKK+RRT KKPYSRSIVGATLEVIQK+RTEKPEVRDAAREAALR
Sbjct: 86 LTWTAMYRKQHKKDIAAEAVKKKRRTAKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAALR 148

GSVIVT010346760019.34e-2790.48%GSVIVT01034676001 assembled CDS
HSP 1
Score: 115.931 bits (289), Expect = 9.33731e-27
Identity = 57/63 (90.48%), Postives = 59/63 (93.65%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
LTWTAMYRKQHKKDIA EAVKKRRR TKKP+SRSIVG TLE IQK+RTEKPEVRDAAREAALR
Sbjct: 51 LTWTAMYRKQHKKDIAAEAVKKRRRATKKPFSRSIVGTTLEAIQKRRTEKPEVRDAAREAALR 113

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: DW043524
Best 10 Hits Shown

Match Name E value Identity Description
AT3G53020.1 5.97e-2792.06%
Ribosomal protein L24e family protein |...
HSP 1
Score: 117.087 bits (292), Expect = 5.9725e-27
Identity = 58/63 (92.06%), Postives = 59/63 (93.65%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
L WTAMYRKQHKKD AQEAVK+RRR TKKPYSRSIVGATLEVIQKKR EKPEVRDAAREAALR
Sbjct: 51 LAWTAMYRKQHKKDAAQEAVKRRRRATKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALR 113

AT2G36620.1 7.80e-2792.06%
ribosomal protein L24 | chr2:15350548-1...
HSP 1
Score: 116.701 bits (291), Expect = 7.80032e-27
Identity = 58/63 (92.06%), Postives = 59/63 (93.65%), Query Frame = 2
Query:    2 LTWTAMYRKQHKKDIAQEAVKKRRRTTKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALR 190
L WTAMYRKQHKKD AQEAVK+RRR TKKPYSRSIVGATLEVIQKKR EKPEVRDAAREAALR
Sbjct: 51 LCWTAMYRKQHKKDAAQEAVKRRRRATKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALR 113

Related info for DW043524