Please Note: This site will be unavailable Thursday May 1st  due to maintenance and content upgrades. We apologize for the inconvenience. 

CF810848

Information for CF810848

NameCF810848
AccessionID749
Length597 bp
TypeEST
Organism highbush blueberry (Vaccinium corymbosum)
Library LIBEST_014530 cDNA cold acclimated Bluecrop library
Is singlet in Vaccinium corymbosum unigene v1
NCBI Accession CF810848
Sequence
AGATTTCAGAATCTTTCATCTGTTGCGTCTGCCTGGATCTTCTCTATAAGCCCATTGTTC
TGGCTTGTGGCCATGTCTCCTGTTTCTGGTGTGTCCATAGAGCCATGAGTAATCTACATG
AGTCTCATTGTCCAATTTGTAGGCAACCATATGGTCATTTTCCAACTATTTGTCAGATGC
TTCATTTCTTGCTTTTAAAGATGTATCCAGTTGCCTACAAGACCAGGGAAACTTACATGC
TAGAAGAGGAAAAGGAGATTGGCTGCTTCTCACCTAAGGTTGATGATCTTCTTCGTTCTT
CGCAGACTAACGAAGAATCGAATCATCTTGATGATCTGGCACAATCCTTTACCTATGGTG
ATGGGGAAAGAAGCCATATCAGAAGTCCAGGGCAGGTTTCAATTGTGGATGTATCATGTG
CTACATGCAAGCAACTACTCTTTCAGCCTGTTGTTCTTAATTGTGGCCATGTATATTGTG
AAGCTTGCATCGTGCTAACTGGTGAGGCAATTAGATGTCAAGTTTGCCAAAGCCCACATC
CAAGTGGTTTTCCAAAAGTTTGTTTGGAACTTGATCATTTCCTGGAAGAACAGTTTN
Download sequence in fasta format

GO terms assigned to this feature

Accession Category Term
GO:0005515 molecular_function protein binding
GO:0008270 molecular_function zinc ion binding

InterProScan Analysis

Analysis Date: 01-18-2011 (InterProScan analysis for Vaccinium corymbosum unigene v1)
SEQUENCE: CF810848_3_ORF1 CRC64: 408B097954E3D04C LENGTH: 198 aa
InterPro
IPR001841
Domain
Zinc finger, RING-type
SM00184 [7-46]T 5.3e-05 SM00184 no description[139-175]T 2.7e-05 SM00184 no description no description
PS50089 [7-47]T 11.560 PS50089 ZF_RING_2[139-176]T 10.247 PS50089 ZF_RING_2 ZF_RING_2
InterPro
IPR013083
Domain
Zinc finger, RING/FYVE/PHD-type
G3DSA:3.30.40.10 [2-62]T 2.2e-11 G3DSA:3.30.40.10 no description[136-196]T 1.9e-08 G3DSA:3.30.40.10 no description no description
InterPro
IPR017907
Conserved_site
Zinc finger, RING-type, conserved site
PS00518 [154-163]T NA PS00518 ZF_RING_1 ZF_RING_1
noIPR
unintegrated
unintegrated
PTHR15898 [1-198]T 1.4e-68 PTHR15898 UNCHARACTERIZED UNCHARACTERIZED
PTHR15898:SF1 [1-198]T 1.4e-68 PTHR15898:SF1 SUBFAMILY NOT NAMED SUBFAMILY NOT NAMED
SSF57850 [2-62]T 3.2e-10 SSF57850 RING/U-box[131-188]T 6e-08 SSF57850 RING/U-box RING/U-box

Poplar (P. trichocarpa) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide)
Query: CF810848
Best 10 Hits Shown

Match Name E value Identity Description
POPTR_0003s177104.03e-5847.70%POPTR_0003s17710.1
HSP 1
Score: 221.09 bits (562), Expect = 4.02584e-58
Identity = 114/239 (47.70%), Postives = 142/239 (59.41%), Query Frame = 3
Query:    9 ESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSSQTNEE--------------SNHLDDLAQSFTYGDGERSHI------RSPG----------------------QVSIVDVSCATCKQLLFQPVVLNCGHVYCEACIVLTGEAI-RCQVCQSPHPSGFPKVCLELDHFLEEQF 596
+ F C VCLDLLYKP+VL CGH+SCFWCV +M+ L ESHCPICR + HFP++CQ+LHFLL+KMYP+AYK RE + EEEK+ G FSP+ S + EE N L ++ + + + RS G Q S+ D+ CA CK+LLFQPVVLNCGHVYCE+CI + I RCQ+CQS HP+G P VCL L+HFLEEQF
Sbjct: 49 DEFQCSVCLDLLYKPVVLGCGHLSCFWCVFYSMNGLRESHCPICRHQFNHFPSVCQLLHFLLMKMYPIAYKRREREVGEEEKKGGRFSPQFVHHPFGSHSGEELDFPSYSQHFPIHPQNKLCYFPKAIAHREENMKIVPSTLSSRSDGTTNAAIENCNLIGTEFGHGIKTQASVADLLCAECKKLLFQPVVLNCGHVYCESCIASPMQGIPRCQICQSLHPNGIPSVCLVLEHFLEEQF 287

HSP 2
Score: 58.151 bits (139), Expect = 4.51346e-09
Identity = 46/166 (27.71%), Postives = 74/166 (44.58%), Query Frame = 3
Query:   18 ICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICR--QPYGHFPTICQML-HFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSSQTNEESNHLDDLAQSFTYGDGERSHIR----SPGQVSIVD--VSCATCKQLLFQPVVLNCGHVYCEAC 488
+C C LL++P+VL CGHV C C+ M + C IC+ P G P++C +L HFL + + + RE + K+ C S L + ++ + + S+ +G+G + HIR S G + I+ C C + G CE+C
Sbjct: 226 LCAECKKLLFQPVVLNCGHVYCESCIASPMQGI--PRCQICQSLHPNG-IPSVCLVLEHFLEEQFSEIYAERREAF----AKQTDCSSSAQTQQLATQSSSVPAK----VYSSWIFGNGPKVHIRVGCDSCGMIPIIGERYKCKDCSE--------EIGFDMCESC 372

POPTR_0001s145907.59e-5747.35%POPTR_0001s14590.1
HSP 1
Score: 216.853 bits (551), Expect = 7.59241e-57
Identity = 116/245 (47.35%), Postives = 140/245 (57.14%), Query Frame = 3
Query:   15 FICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSSQTNEE----SNHLDDLAQS---------FTYGDGERSHIRSPGQV-------------------------------------SIVDVSCATCKQLLFQPVVLNCGHVYCEACIVLTGEAI-RCQVCQSPHPSGFPKVCLELDHFLEEQF 596
F C VCLDLLYKP+VLACGH SCFWCV R M+ ESHCPICR P+ HFP +CQ+LHFLL+KM P+AYKTRE + EEEK+ G FSP+ S EE SN L S F+ G+ + S V S+ D+ CA CK+LLF+PVVLNCGHVYCE+CI++ + I RCQ CQS HP+GFP VCL L++FLEE F
Sbjct: 52 FQCPVCLDLLYKPVVLACGHFSCFWCVFRCMNGFRESHCPICRHPFNHFPRVCQLLHFLLMKMCPIAYKTREGEVEEEEKKFGLFSPQFGHHSSGSLPGEELDVPSNSLRLPTHSQTKLGYDSCFSLGNFPEAIAHSVDNVKIMPSSPLSISEGTANAAIKSCNLIRTGLGRGIQKQASVADLLCAECKKLLFRPVVLNCGHVYCESCIIIPMQGIPRCQFCQSLHPNGFPGVCLLLENFLEEHF 296

POPTR_0002s243302.99e-5355.62%POPTR_0002s24330.1
HSP 1
Score: 204.912 bits (520), Expect = 2.98562e-53
Identity = 99/178 (55.62%), Postives = 112/178 (62.92%), Query Frame = 3
Query:   63 ACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSSQTNEESNHLDDLAQSFTYGDGERSHIRSPGQVSIVDVSCATCKQLLFQPVVLNCGHVYCEACIVLTGEAIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
ACGH+SCFWCVH++MS L ES+CPICR PY HFPTICQMLHFLL K+YP+ Y RE LE ++ ++SN R+ QVSI DV C+TCKQLLF PVVLNCGHVYCE CI E + CQVCQS HP GFPKVCLE DHFLEE F
Sbjct: 22 ACGHISCFWCVHKSMSGLRESNCPICRHPYNHFPTICQMLHFLLFKLYPMVYTRREEQTLE-----------------NNLPEDKSN-------------------RNCKQVSIADVQCSTCKQLLFHPVVLNCGHVYCETCIGPVNEMLTCQVCQSLHPRGFPKVCLEFDHFLEEYF 163

POPTR_0012s070005.52e-0732.91%POPTR_0012s07000.4
HSP 1
Score: 51.2174 bits (121), Expect = 5.51733e-07
Identity = 26/79 (32.91%), Postives = 42/79 (53.16%), Query Frame = 3
Query:    6 SESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQM---LHFLLLKMYPVAYKTRET 233
S+ F C +CL LL++PI CGH C C+ ++M + CP+CR P C + L+ ++ K +P Y R++
Sbjct: 37 SDEFDCTLCLKLLFEPITTPCGHSFCRSCLFQSMD--RGNKCPLCRTVLFISPRTCSISVTLNNIIQKNFPEEYAERKS 113

POPTR_0012s070005.52e-0732.91%POPTR_0012s07000.3
HSP 1
Score: 51.2174 bits (121), Expect = 5.51733e-07
Identity = 26/79 (32.91%), Postives = 42/79 (53.16%), Query Frame = 3
Query:    6 SESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQM---LHFLLLKMYPVAYKTRET 233
S+ F C +CL LL++PI CGH C C+ ++M + CP+CR P C + L+ ++ K +P Y R++
Sbjct: 193 SDEFDCTLCLKLLFEPITTPCGHSFCRSCLFQSMD--RGNKCPLCRTVLFISPRTCSISVTLNNIIQKNFPEEYAERKS 269

POPTR_0012s070005.52e-0732.91%POPTR_0012s07000.2
HSP 1
Score: 51.2174 bits (121), Expect = 5.51733e-07
Identity = 26/79 (32.91%), Postives = 42/79 (53.16%), Query Frame = 3
Query:    6 SESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQM---LHFLLLKMYPVAYKTRET 233
S+ F C +CL LL++PI CGH C C+ ++M + CP+CR P C + L+ ++ K +P Y R++
Sbjct: 193 SDEFDCTLCLKLLFEPITTPCGHSFCRSCLFQSMD--RGNKCPLCRTVLFISPRTCSISVTLNNIIQKNFPEEYAERKS 269

POPTR_0012s070005.52e-0732.91%POPTR_0012s07000.1
HSP 1
Score: 51.2174 bits (121), Expect = 5.51733e-07
Identity = 26/79 (32.91%), Postives = 42/79 (53.16%), Query Frame = 3
Query:    6 SESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQM---LHFLLLKMYPVAYKTRET 233
S+ F C +CL LL++PI CGH C C+ ++M + CP+CR P C + L+ ++ K +P Y R++
Sbjct: 193 SDEFDCTLCLKLLFEPITTPCGHSFCRSCLFQSMD--RGNKCPLCRTVLFISPRTCSISVTLNNIIQKNFPEEYAERKS 269

Peach (P. persica) homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide)
Query: CF810848
Best 10 Hits Shown

Match Name E value Identity Description
ppa016728m 6.55e-7159.72%ppa016728m
HSP 1
Score: 263.077 bits (671), Expect = 6.54623e-71
Identity = 129/216 (59.72%), Postives = 151/216 (69.91%), Query Frame = 3
Query:    3 ISESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSSQTNEE------------SNHLDDLAQSFTYGDGERSHI-----RSPGQVSIVDVSCATCKQLLFQPVVLNCGHVYCEACIVLTGE-AIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
I +SFICCVCLDLLYKPIVL+CGHVSCFWCVHR+MS+L +S CP+CR Y HFPTICQMLHFLLLK YPVAYK RE +LEEEK GCFSP++D +SQ +++ D + D E++ + S ++S+ DV CA CKQL F PVVLNCGHVYCE+CIV E +RC VCQS HPSGFPKVCL L HFLEEQF
Sbjct: 6 IPDSFICCVCLDLLYKPIVLSCGHVSCFWCVHRSMSSLGQSQCPLCRHEYNHFPTICQMLHFLLLKKYPVAYKRRELQILEEEKRSGCFSPQLDAHGCNSQASQDLHIQNNGTAGPKQTRGGDYEGTGNVTDEEKNSLLNTDSGSADRISVADVICAACKQLSFHPVVLNCGHVYCESCIVKPDEQMLRCNVCQSSHPSGFPKVCLVLGHFLEEQF 221

ppa008328m 2.28e-2365.22%ppa008328m
HSP 1
Score: 105.145 bits (261), Expect = 2.28144e-23
Identity = 45/69 (65.22%), Postives = 57/69 (82.61%), Query Frame = 3
Query:  393 QVSIVDVSCATCKQLLFQPVVLNCGHVYCEACIVLTGEAI-RCQVCQSPHPSGFPKVCLELDHFLEEQF 596
+VS+ D+ CA CK LLFQPVVLNCGHVYC++CI + + + RCQ+CQS HP+GFP VCL L+HFLEEQ+
Sbjct: 43 KVSVSDLLCAACKNLLFQPVVLNCGHVYCKSCINIPVDGVSRCQICQSMHPNGFPSVCLILEHFLEEQY 111

HSP 2
Score: 58.151 bits (139), Expect = 3.19828e-09
Identity = 26/78 (33.33%), Postives = 46/78 (58.97%), Query Frame = 3
Query:   18 ICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGH-FPTICQMLHFLLLKMYPVAYKTRETYMLEE 248
+C C +LL++P+VL CGHV C C++ + + S C IC+ + + FP++C +L L + YP Y R + +++
Sbjct: 50 LCAACKNLLFQPVVLNCGHVYCKSCINIPVDGV--SRCQICQSMHPNGFPSVCLILEHFLEEQYPEIYAHRRSSSIKQ 125

ppa005453m 3.91e-0733.33%ppa005453m
HSP 1
Score: 51.2174 bits (121), Expect = 3.90963e-07
Identity = 26/78 (33.33%), Postives = 41/78 (52.56%), Query Frame = 3
Query:    6 SESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQM---LHFLLLKMYPVAYKTRE 230
S+ F C +CL LLY+P+ CGH C C+ +AM + CP+CR P C + L+ ++ K +P + R+
Sbjct: 165 SDDFDCTLCLKLLYEPVTTPCGHSFCRSCLFQAMD--RGNKCPLCRTVLFISPRTCAISVTLNDIIQKNFPEEFAERK 240

ppa004836m 3.91e-0733.33%ppa004836m
HSP 1
Score: 51.2174 bits (121), Expect = 3.90963e-07
Identity = 26/78 (33.33%), Postives = 41/78 (52.56%), Query Frame = 3
Query:    6 SESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQM---LHFLLLKMYPVAYKTRE 230
S+ F C +CL LLY+P+ CGH C C+ +AM + CP+CR P C + L+ ++ K +P + R+
Sbjct: 194 SDDFDCTLCLKLLYEPVTTPCGHSFCRSCLFQAMD--RGNKCPLCRTVLFISPRTCAISVTLNDIIQKNFPEEFAERK 269

Swissprot homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot)
Query: CF810848
Best 10 Hits Shown

Match Name E value Identity Description
PRT1_ARATH7.54e-5747.23%
E3 ubiquitin-protein ligase PRT1 OS=Arab...
HSP 1
Score: 219.935 bits (559), Expect = 7.54022e-57
Identity = 111/235 (47.23%), Postives = 146/235 (62.13%), Query Frame = 3
Query:    3 ISESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSSQTNEESNHLDD-------------LAQSFTYGD------------------GERSHIRS---PGQVSIVDVSCATCKQLLFQPVVLNCGHVYCEACIV---LTGEAIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
I + F+CCVCL+LLYKPIVL+CGH+SCFWCVH++M+ ESHCPICR PY HFP++CQ L+FLL KMYP+A+K RE +L+EE+E CFSP++D +L S + +S ++ D L+ S + GD E ++ Q+S D+ C+ CK+LL +PVVLNCGHVYCE C+V E I+CQ C P GFPKVCL L+ LEE F
Sbjct: 20 IPDQFLCCVCLELLYKPIVLSCGHLSCFWCVHKSMNGFRESHCPICRDPYVHFPSVCQKLYFLLKKMYPLAHKKREEQVLKEEQERECFSPQIDLVLDLSVCSGDSLNVSDKQKVEECSNAANLLSSSSSRGDIPCIPKNQEPTDAKALNVHENELLKDNKVSKQISKDDLLCSACKELLVRPVVLNCGHVYCEGCVVDMAEESEKIKCQECNVCDPRGFPKVCLILEQLLEENF 254

BFAR_RAT9.35e-0735.71%
Bifunctional apoptosis regulator OS=Ratt...
HSP 1
Score: 53.5286 bits (127), Expect = 9.34646e-07
Identity = 30/84 (35.71%), Postives = 42/84 (50.00%), Query Frame = 3
Query:  357 GDGERSHIRSPG-QVSIVDVSCATCKQLLFQPVVLNCGHVYCEACIVL---TGEAIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
G E +RS G Q+S+ + SC C L P LNCGH +C C+ L + + C C+ GFPKV + L +E+ F
Sbjct: 13 GQEEDHPVRSSGPQISVSEFSCHCCYDTLVNPTTLNCGHSFCRHCLALWWMSSKKTECPECREKW-EGFPKVNILLRDAIEKLF 95

TrEMBL homologs

Analysis Date: 01-18-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL)
Query: CF810848
Best 10 Hits Shown

Match Name E value Identity Description
B9S532_RICCO8.01e-6456.60%
Putative uncharacterized protein OS=Rici...
HSP 1
Score: 246.899 bits (629), Expect = 8.00641e-64
Identity = 120/212 (56.60%), Postives = 143/212 (67.45%), Query Frame = 3
Query:    3 ISESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSSQTNEESNHLDDLAQ-----------SFTYGDGERSHIRSPGQVSIVDVSCATCKQLLFQPVVLNCGHVYCEACI---VLTGEAIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
I +SF+CC+CLDLL+KPIVLACGHVSCFWCVH++MS ES CPICR PY HFPT+ QMLH LL +YP+AYK RE +L EEK++G FSP+ D S N+E +HL D S T E ++SI DV CA CKQL+F+PV LNCG YCE+CI V +RCQVC S HP+GFPKVCLELDHFLE+QF
Sbjct: 7 IPDSFLCCICLDLLFKPIVLACGHVSCFWCVHKSMSGRRESCCPICRHPYNHFPTVSQMLHALLFNIYPIAYKRREELILAEEKQMGYFSPQFDYTACQSPENQEYDHLKDHEHLSTTSLESDSCSETCSTREGEPKGKSKRLSITDVLCAACKQLVFRPVFLNCGQGYCESCISCSVDENGMLRCQVCHSLHPTGFPKVCLELDHFLEDQF 218

D7U3J4_VITVI2.85e-6150.61%
Whole genome shotgun sequence of line PN...
HSP 1
Score: 238.424 bits (607), Expect = 2.84763e-61
Identity = 125/247 (50.61%), Postives = 139/247 (56.28%), Query Frame = 3
Query:   30 CLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVD----------------------------DLLRSSQTNEESNHLDDL------------------------AQSFTYGDGERSHIRSP-----GQVSIVDVSCATCKQLLFQPVVLNCGHVYCEACI-VLTGEAIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
C DLLYKPIVLACGH+SCFWCVH +M HESHCPICR PY HFPTICQMLHF+LLKMYPVAYK RE LE E+E CFSP+ D L S +N H DL Q T D E +++ Q+SI DV C CKQLLF+PVVLNCGHVYCE C + E RC+VCQ HPSGFPKVCLELD+FLEEQF
Sbjct: 8 CRDLLYKPIVLACGHISCFWCVHYSMDGAHESHCPICRNPYSHFPTICQMLHFMLLKMYPVAYKRREKQTLEREEETRCFSPRFDAYGGGSHTYKKLKIEADPADPSITVFEFKLCPDSSSNRVKKHFADLMQRQPVSLPQDFVIPISKQTSGGNPQGATLADEENVVLKNNLDQTCEQLSIADVQCTACKQLLFRPVVLNCGHVYCETCFNIPVDERFRCKVCQVLHPSGFPKVCLELDNFLEEQF 254

B9GQH3_POPTR2.85e-6150.40%
Predicted protein (Fragment) OS=Populus ...
HSP 1
Score: 238.424 bits (607), Expect = 2.84763e-61
Identity = 125/248 (50.40%), Postives = 142/248 (57.26%), Query Frame = 3
Query:    6 SESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSP-----KVDDLLRSSQTNEESNHLDDLAQSFTYGD--GERSHIRSPGQVS--------------------------------------------IVDVSCATCKQLLFQPVVLNCGHVYCEACIVLTGEAIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
S+SF C VCLDLLYKPIVL+CGH+SCFWCVH++MS L ES+CPICR PY HFPTICQMLHFLL K+YP+ Y RE LEEE E+G FSP + + L+ + + LD F G+ G I S VS I DV C+TCKQLLF PVVLNCGHVYCE CI E + CQVCQS HP GFPKVCLE DHFLEE F
Sbjct: 21 SDSFRCSVCLDLLYKPIVLSCGHISCFWCVHKSMSGLRESNCPICRHPYNHFPTICQMLHFLLFKLYPMVYTRREEQTLEEEMEMGFFSPQFGYKECNSDLKHHHPRDRKHALDSC--FFRNGEFCGSTQQIESVKSVSMIQAPTMSIPNKVCDENCCMIKPDSVEENNLPEDKSNRNCKQVSIADVQCSTCKQLLFHPVVLNCGHVYCETCIGPVNEMLTCQVCQSLHPRGFPKVCLEFDHFLEEYF 266

A9PEV7_POPTR2.85e-6150.40%
Putative uncharacterized protein OS=Popu...
HSP 1
Score: 238.424 bits (607), Expect = 2.84763e-61
Identity = 125/248 (50.40%), Postives = 142/248 (57.26%), Query Frame = 3
Query:    6 SESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSP-----KVDDLLRSSQTNEESNHLDDLAQSFTYGD--GERSHIRSPGQVS--------------------------------------------IVDVSCATCKQLLFQPVVLNCGHVYCEACIVLTGEAIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
S+SF C VCLDLLYKPIVL+CGH+SCFWCVH++MS L ES+CPICR PY HFPTICQMLHFLL K+YP+ Y RE LEEE E+G FSP + + L+ + + LD F G+ G I S VS I DV C+TCKQLLF PVVLNCGHVYCE CI E + CQVCQS HP GFPKVCLE DHFLEE F
Sbjct: 34 SDSFRCSVCLDLLYKPIVLSCGHISCFWCVHKSMSGLRESNCPICRHPYNHFPTICQMLHFLLFKLYPMVYTRREEQTLEEEMEMGFFSPQFGYKECNSDLKHHHPRDRKHALDSC--FFRNGEFCGSTQQIESVKSVSMIQAPTMSIPNKVCDENCCMIKPDSVEENNLPEDKSNRNCKQVSIADVQCSTCKQLLFHPVVLNCGHVYCETCIGPVNEMLTCQVCQSLHPRGFPKVCLEFDHFLEEYF 279

Q6K9N9_ORYSJ5.94e-5953.92%
Os02g0621500 protein OS=Oryza sativa sub...
HSP 1
Score: 230.72 bits (587), Expect = 5.93767e-59
Identity = 110/204 (53.92%), Postives = 139/204 (68.14%), Query Frame = 3
Query:   15 FICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSSQTN---------EESNHLDDLAQSFTYGDGERSHIRSPGQVSIVDVSCATCKQLLFQPVVLNCGHVYCEACI-VLTGEAIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
F CCVCL+LLYKP+V+ACGH+SCFWCVH AM + ESHC +CRQPY HFP+ICQ+LH LL+K+ PV YK RE +LE+EK + +SP++ + L S N EESN Q T DG + P +V + DVSCA CK+LL+QP VLNCGHVYC +C+ L A++CQVC HP FP VCL+LDHF+E+ F
Sbjct: 42 FQCCVCLELLYKPVVIACGHMSCFWCVHNAMHIIRESHCAVCRQPYKHFPSICQLLHHLLIKLEPVEYKRREKEVLEDEKRVDTYSPQIIEFLNSKSNNCEIDGENRPEESNSRP--PQEVT-SDGNTIN-GHPKKVKLEDVSCALCKELLYQPAVLNCGHVYCMSCLSSLDDGALKCQVCGGLHPGDFPNVCLDLDHFIEDYF 241

B8AFI4_ORYSI5.94e-5953.92%
Putative uncharacterized protein OS=Oryz...
HSP 1
Score: 230.72 bits (587), Expect = 5.93767e-59
Identity = 110/204 (53.92%), Postives = 139/204 (68.14%), Query Frame = 3
Query:   15 FICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSSQTN---------EESNHLDDLAQSFTYGDGERSHIRSPGQVSIVDVSCATCKQLLFQPVVLNCGHVYCEACI-VLTGEAIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
F CCVCL+LLYKP+V+ACGH+SCFWCVH AM + ESHC +CRQPY HFP+ICQ+LH LL+K+ PV YK RE +LE+EK + +SP++ + L S N EESN Q T DG + P +V + DVSCA CK+LL+QP VLNCGHVYC +C+ L A++CQVC HP FP VCL+LDHF+E+ F
Sbjct: 42 FQCCVCLELLYKPVVIACGHMSCFWCVHNAMHIIRESHCAVCRQPYKHFPSICQLLHHLLIKLEPVEYKRREKEVLEDEKRVDTYSPQIIEFLNSKSNNCEIDGENRPEESNSRP--PQEVT-SDGNTIN-GHPKKVKLEDVSCALCKELLYQPAVLNCGHVYCMSCLSSLDDGALKCQVCGGLHPGDFPNVCLDLDHFIEDYF 241

B9H0A3_POPTR4.70e-5647.70%
Predicted protein OS=Populus trichocarpa...
HSP 1
Score: 221.09 bits (562), Expect = 4.7047e-56
Identity = 114/239 (47.70%), Postives = 142/239 (59.41%), Query Frame = 3
Query:    9 ESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSSQTNEE--------------SNHLDDLAQSFTYGDGERSHI------RSPG----------------------QVSIVDVSCATCKQLLFQPVVLNCGHVYCEACIVLTGEAI-RCQVCQSPHPSGFPKVCLELDHFLEEQF 596
+ F C VCLDLLYKP+VL CGH+SCFWCV +M+ L ESHCPICR + HFP++CQ+LHFLL+KMYP+AYK RE + EEEK+ G FSP+ S + EE N L ++ + + + RS G Q S+ D+ CA CK+LLFQPVVLNCGHVYCE+CI + I RCQ+CQS HP+G P VCL L+HFLEEQF
Sbjct: 49 DEFQCSVCLDLLYKPVVLGCGHLSCFWCVFYSMNGLRESHCPICRHQFNHFPSVCQLLHFLLMKMYPIAYKRREREVGEEEKKGGRFSPQFVHHPFGSHSGEELDFPSYSQHFPIHPQNKLCYFPKAIAHREENMKIVPSTLSSRSDGTTNAAIENCNLIGTEFGHGIKTQASVADLLCAECKKLLFQPVVLNCGHVYCESCIASPMQGIPRCQICQSLHPNGIPSVCLVLEHFLEEQF 287

HSP 2
Score: 58.151 bits (139), Expect = 5.27455e-07
Identity = 46/166 (27.71%), Postives = 74/166 (44.58%), Query Frame = 3
Query:   18 ICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICR--QPYGHFPTICQML-HFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSSQTNEESNHLDDLAQSFTYGDGERSHIR----SPGQVSIVD--VSCATCKQLLFQPVVLNCGHVYCEAC 488
+C C LL++P+VL CGHV C C+ M + C IC+ P G P++C +L HFL + + + RE + K+ C S L + ++ + + S+ +G+G + HIR S G + I+ C C + G CE+C
Sbjct: 226 LCAECKKLLFQPVVLNCGHVYCESCIASPMQGI--PRCQICQSLHPNG-IPSVCLVLEHFLEEQFSEIYAERREAF----AKQTDCSSSAQTQQLATQSSSVPAK----VYSSWIFGNGPKVHIRVGCDSCGMIPIIGERYKCKDCSE--------EIGFDMCESC 372

D7L5T1_ARALY3.05e-5545.23%
Putative uncharacterized protein OS=Arab...
HSP 1
Score: 218.394 bits (555), Expect = 3.0495e-55
Identity = 109/241 (45.23%), Postives = 147/241 (61.00%), Query Frame = 3
Query:    3 ISESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSS-------------------QTNEESNHLDDLAQSFTYG------------DGERSHI---------RSPGQVSIVDVSCATCKQLLFQPVVLNCGHVYCEACIV---LTGEAIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
I + F+CCVCL+LLYKPIVL+CGH+SCFWCVH++M+ ESHCPICR PY HFP++CQ L+FLL KMYP+A+K RE +L+EE+E+ CFSP++D +L + + +E SN + L+ S + G D + ++ + Q+S D+ C+ CK+LL +PVVLNCGHVYCE C+V E I+C C P GFPKVCL L+ LEE F
Sbjct: 20 IPDQFLCCVCLELLYKPIVLSCGHLSCFWCVHKSMNGFRESHCPICRDPYVHFPSVCQKLYFLLKKMYPLAHKKREEQVLKEEQELDCFSPQIDVVLEETKVKDVSVCSGDSLNVSDKQKVDECSNAANLLSSSSSRGGSPCIPSNQEPTDAQTLNVHENELPKNNKVSNQISKDDLLCSACKELLVRPVVLNCGHVYCEGCVVDMAEESEKIKCLECNVCDPRGFPKVCLILEQLLEENF 260

A9TLB7_PHYPA5.40e-4439.91%
Predicted protein (Fragment) OS=Physcomi...
HSP 1
Score: 181.03 bits (458), Expect = 5.39537e-44
Identity = 93/233 (39.91%), Postives = 132/233 (56.65%), Query Frame = 3
Query:    9 ESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSSQTNEESNHLDDLAQSFTYGDGERSHIRSP-------------------GQ-----------------VSIVDVSCATCKQLLFQPVVLNCGHVYCEACIVLTGE-AIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
E F C +CL+L+YKPIV ACGH+ CFWCVHRAM H++ CP+CR+PY HFP IC+ LHF+LLK+ Y R + +EE E G FSP++D RS ++ + + L +S G+G S+ S GQ V+ D++C C LL++PVVLNCGH++CE C+ + + A+ C C++ HP FP+VCLEL H+++ F
Sbjct: 1 EQFQCIICLELVYKPIVHACGHLFCFWCVHRAMGGTHKNLCPLCRRPYMHFPRICEQLHFVLLKVVHDKYLCRAKEVQKEEIEAGIFSPQLDLPPRSRTSSGDIETVSFLNRSSECGNGCASNSSSSVGDDPRKAPVADEGETDFEGQQLRTKDEDPDTSLSYLIVTTSDLTCLHCCNLLYRPVVLNCGHMFCEHCVEIDDDNAVSCPSCKAEHPGMFPQVCLELHHYIDRVF 233

HSP 2
Score: 63.1586 bits (152), Expect = 1.63964e-08
Identity = 31/88 (35.23%), Postives = 49/88 (55.68%), Query Frame = 3
Query:   21 CCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPY-GHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKV 281
C C +LLY+P+VL CGH+ C CV + + + CP C+ + G FP +C LH + +++P+ Y R + EE+E P+V
Sbjct: 173 CLHCCNLLYRPVVLNCGHMFCEHCVE--IDDDNAVSCPSCKAEHPGMFPQVCLELHHYIDRVFPLEYAQRSLQVAAEERERPSNRPQV 258

B9RWJ2_RICCO1.09e-3638.84%
Putative uncharacterized protein OS=Rici...
HSP 1
Score: 156.762 bits (395), Expect = 1.08965e-36
Identity = 87/224 (38.84%), Postives = 114/224 (50.89%), Query Frame = 3
Query:  105 MSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSSQTN---------------------------------------EESNHLD---DLAQSFTYGDGERSHIRSPGQVSIV-----------------DVSCATCKQLLFQPVVLNCGHVYCEACIVL-TGEAIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
M+ HES+CP+CR PY HFP +C++LHFLLLKMYP+AYK RE + EEEK++G FSP+ D + S +N E + H++ D S Y E S + + S+ D+ CA CK LLF+P+VLNCGHVYCE CI E RC +CQS HP+GFP +CL L+ FLE+ F
Sbjct: 1 MNFWHESNCPVCRHPYNHFPNVCRLLHFLLLKMYPIAYKRREKQVGEEEKQMGHFSPQFDHHVFGSHSNQDVDVPNKSVLSPTDVMAQDYSDDCFSRQTKSSSLPNSLEATKHINDTIDATPSTLYRSSEGSGSTATEKCSLTGEELEDRTLKQCSVSVSDLQCAECKNLLFRPLVLNCGHVYCETCICTPMAETPRCGICQSLHPNGFPGICLLLEQFLEKHF 224

HSP 2
Score: 60.077 bits (144), Expect = 1.38804e-07
Identity = 49/166 (29.52%), Postives = 70/166 (42.17%), Query Frame = 3
Query:   21 CCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICR--QPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDD--LLRSSQTNEESNHLDDLAQSFTYGDGERSHIR----SPGQVSIVD--VSCATCKQLLFQPVVLNCGHVYCEAC 488
C C +LL++P+VL CGHV C C+ M+ C IC+ P G FP IC +L L K +P Y R +L K+ C + K + Q S + S+ +G+G + H S G I+ C C + + G CEAC
Sbjct: 164 CAECKNLLFRPLVLNCGHVYCETCICTPMA--ETPRCGICQSLHPNG-FPGICLLLEQFLEKHFPKIYAKRREGLL---KQTDCLAAKRQEGSTQVQHQAKRSSMFPSSIFSSWLFGNGPKVHYAVGCDSCGMSPIIGERYKCKDCMEKM--------GFDLCEAC 315

Grape (V. vinifera) homologs

Analysis Date: 01-25-2011 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide)
Query: CF810848
Best 10 Hits Shown

Match Name E value Identity Description
GSVIVT010286430011.48e-6350.61%GSVIVT01028643001 assembled CDS
HSP 1
Score: 238.424 bits (607), Expect = 1.47803e-63
Identity = 125/247 (50.61%), Postives = 139/247 (56.28%), Query Frame = 3
Query:   30 CLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVD----------------------------DLLRSSQTNEESNHLDDL------------------------AQSFTYGDGERSHIRSP-----GQVSIVDVSCATCKQLLFQPVVLNCGHVYCEACI-VLTGEAIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
C DLLYKPIVLACGH+SCFWCVH +M HESHCPICR PY HFPTICQMLHF+LLKMYPVAYK RE LE E+E CFSP+ D L S +N H DL Q T D E +++ Q+SI DV C CKQLLF+PVVLNCGHVYCE C + E RC+VCQ HPSGFPKVCLELD+FLEEQF
Sbjct: 8 CRDLLYKPIVLACGHISCFWCVHYSMDGAHESHCPICRNPYSHFPTICQMLHFMLLKMYPVAYKRREKQTLEREEETRCFSPRFDAYGGGSHTYKKLKIEADPADPSITVFEFKLCPDSSSNRVKKHFADLMQRQPVSLPQDFVIPISKQTSGGNPQGATLADEENVVLKNNLDQTCEQLSIADVQCTACKQLLFRPVVLNCGHVYCETCFNIPVDERFRCKVCQVLHPSGFPKVCLELDNFLEEQF 254

GSVIVT010079610011.50e-0732.91%GSVIVT01007961001 assembled CDS
HSP 1
Score: 52.373 bits (124), Expect = 1.50223e-07
Identity = 26/79 (32.91%), Postives = 43/79 (54.43%), Query Frame = 3
Query:    6 SESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQM---LHFLLLKMYPVAYKTRET 233
S+ F C +CL LL++P+ ACGH C C+ +AM + CP+CR P C + L+ ++ + +P Y R++
Sbjct: 191 SDDFDCTLCLKLLFEPVTTACGHSFCRSCLFQAMD--CSNKCPLCRMVLFINPKTCSISVTLNNIIQRNFPEEYAERKS 267

Arabidopsis (A. thaliana) homologs

Analysis Date: 02-10-2011 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide)
Query: CF810848
Best 10 Hits Shown

Match Name E value Identity Description
AT3G24800.1 7.90e-5847.23%
proteolysis 1 | chr3:9055653-9057795 FO...
HSP 1
Score: 219.935 bits (559), Expect = 7.9027e-58
Identity = 111/235 (47.23%), Postives = 146/235 (62.13%), Query Frame = 3
Query:    3 ISESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQMLHFLLLKMYPVAYKTRETYMLEEEKEIGCFSPKVDDLLRSSQTNEESNHLDD-------------LAQSFTYGD------------------GERSHIRS---PGQVSIVDVSCATCKQLLFQPVVLNCGHVYCEACIV---LTGEAIRCQVCQSPHPSGFPKVCLELDHFLEEQF 596
I + F+CCVCL+LLYKPIVL+CGH+SCFWCVH++M+ ESHCPICR PY HFP++CQ L+FLL KMYP+A+K RE +L+EE+E CFSP++D +L S + +S ++ D L+ S + GD E ++ Q+S D+ C+ CK+LL +PVVLNCGHVYCE C+V E I+CQ C P GFPKVCL L+ LEE F
Sbjct: 20 IPDQFLCCVCLELLYKPIVLSCGHLSCFWCVHKSMNGFRESHCPICRDPYVHFPSVCQKLYFLLKKMYPLAHKKREEQVLKEEQERECFSPQIDLVLDLSVCSGDSLNVSDKQKVEECSNAANLLSSSSSRGDIPCIPKNQEPTDAKALNVHENELLKDNKVSKQISKDDLLCSACKELLVRPVVLNCGHVYCEGCVVDMAEESEKIKCQECNVCDPRGFPKVCLILEQLLEENF 254

HSP 2
Score: 53.1434 bits (126), Expect = 1.27937e-07
Identity = 27/77 (35.06%), Postives = 39/77 (50.65%), Query Frame = 3
Query:    9 ESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICR--QPYGHFPTICQMLHFLLLKMYPVAYKTRET 233
+ +C C +LL +P+VL CGHV C CV + C C P G FP +C +L LL + +P Y +R +
Sbjct: 188 DDLLCSACKELLVRPVVLNCGHVYCEGCVVDMAEESEKIKCQECNVCDPRG-FPKVCLILEQLLEENFPEEYNSRSS 263

AT1G18660.1 2.18e-0734.18%
zinc finger (C3HC4-type RING finger) fa...
HSP 1
Score: 52.373 bits (124), Expect = 2.18227e-07
Identity = 27/79 (34.18%), Postives = 41/79 (51.90%), Query Frame = 3
Query:    6 SESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQM---LHFLLLKMYPVAYKTRET 233
S+ F C VCL LLY+P CGH C C+ ++M + CP+CR P C + L+ ++ K +P Y R++
Sbjct: 191 SDDFDCTVCLKLLYEPATTPCGHTFCRSCLFQSMD--RGNKCPLCRTVIFMTPRTCAVSVTLNNIIEKNFPEEYAERKS 267

AT1G18660.3 2.18e-0734.18%
zinc finger (C3HC4-type RING finger) fa...
HSP 1
Score: 52.373 bits (124), Expect = 2.18227e-07
Identity = 27/79 (34.18%), Postives = 41/79 (51.90%), Query Frame = 3
Query:    6 SESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQM---LHFLLLKMYPVAYKTRET 233
S+ F C VCL LLY+P CGH C C+ ++M + CP+CR P C + L+ ++ K +P Y R++
Sbjct: 191 SDDFDCTVCLKLLYEPATTPCGHTFCRSCLFQSMD--RGNKCPLCRTVIFMTPRTCAVSVTLNNIIEKNFPEEYAERKS 267

AT1G18660.2 2.18e-0734.18%
zinc finger (C3HC4-type RING finger) fa...
HSP 1
Score: 52.373 bits (124), Expect = 2.18227e-07
Identity = 27/79 (34.18%), Postives = 41/79 (51.90%), Query Frame = 3
Query:    6 SESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQM---LHFLLLKMYPVAYKTRET 233
S+ F C VCL LLY+P CGH C C+ ++M + CP+CR P C + L+ ++ K +P Y R++
Sbjct: 191 SDDFDCTVCLKLLYEPATTPCGHTFCRSCLFQSMD--RGNKCPLCRTVIFMTPRTCAVSVTLNNIIEKNFPEEYAERKS 267

AT1G18660.4 2.18e-0734.18%
zinc finger (C3HC4-type RING finger) fa...
HSP 1
Score: 52.373 bits (124), Expect = 2.18227e-07
Identity = 27/79 (34.18%), Postives = 41/79 (51.90%), Query Frame = 3
Query:    6 SESFICCVCLDLLYKPIVLACGHVSCFWCVHRAMSNLHESHCPICRQPYGHFPTICQM---LHFLLLKMYPVAYKTRET 233
S+ F C VCL LLY+P CGH C C+ ++M + CP+CR P C + L+ ++ K +P Y R++
Sbjct: 191 SDDFDCTVCLKLLYEPATTPCGHTFCRSCLFQSMD--RGNKCPLCRTVIFMTPRTCAVSVTLNNIIEKNFPEEYAERKS 267

Related info for CF810848