CF811157
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF811157 vs. DB:swissprot:display
Match: NLTP2_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=2 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 4.211e-9 Identity = 25/37 (67.57%), Postives = 32/37 (86.49%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 ++ I G+N+GLAS LPGKCGVN+PYKISPS +C +VK Sbjct: 84 AAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSVK 120
BLAST of CF811157 vs. DB:swissprot:display
Match: NLTP1_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum PE=3 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 4.211e-9 Identity = 25/37 (67.57%), Postives = 32/37 (86.49%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 ++ I G+N+GLAS LPGKCGVN+PYKISPS +C +VK Sbjct: 80 AAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSVK 116
BLAST of CF811157 vs. DB:swissprot:display
Match: NLTP5_VITSX (Non-specific lipid-transfer protein P5 OS=Vitis sp. PE=1 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 7.182e-9 Identity = 25/36 (69.44%), Postives = 30/36 (83.33%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATV 109 S +I G+N+GLA+ LPGKCGVN+PYKISPS NC V Sbjct: 55 SKSISGVNFGLAAGLPGKCGVNIPYKISPSTNCDQV 90
BLAST of CF811157 vs. DB:swissprot:display
Match: NLTP_PRUAV (Non-specific lipid-transfer protein OS=Prunus avium PE=1 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 1.225e-8 Identity = 25/37 (67.57%), Postives = 32/37 (86.49%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 S+++ G+N A++LPGKCGVN+PYKISPS NCATVK Sbjct: 81 SASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117
BLAST of CF811157 vs. DB:swissprot:display
Match: NLTP_PYRCO (Non-specific lipid-transfer protein OS=Pyrus communis PE=1 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 3.564e-8 Identity = 25/37 (67.57%), Postives = 30/37 (81.08%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 + ++ G+N G A SLPGKCGVN+PYKIS S NCATVK Sbjct: 79 AGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115
BLAST of CF811157 vs. DB:swissprot:display
Match: LTP1_MORNI (Non-specific lipid-transfer protein 1 OS=Morus nigra PE=1 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 6.080e-8 Identity = 24/36 (66.67%), Postives = 31/36 (86.11%), Query Frame = 2 Query: 5 SAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 ++IKGLN LA+ LPGKCGV++PYKISPS +C +VK Sbjct: 56 NSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91
BLAST of CF811157 vs. DB:swissprot:display
Match: NLTP4_ARATH (Non-specific lipid-transfer protein 4 OS=Arabidopsis thaliana GN=LTP4 PE=2 SV=1) HSP 1 Score: 55.8398 bits (133), Expect = 7.941e-8 Identity = 25/36 (69.44%), Postives = 29/36 (80.56%), Query Frame = 2 Query: 5 SAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 SA KG+N LAS LPGKCGV++PY IS S NCAT+K Sbjct: 77 SAAKGVNPSLASGLPGKCGVSIPYPISTSTNCATIK 112
BLAST of CF811157 vs. DB:swissprot:display
Match: NLTP1_PRUAR (Non-specific lipid-transfer protein 1 OS=Prunus armeniaca PE=1 SV=2) HSP 1 Score: 55.8398 bits (133), Expect = 7.941e-8 Identity = 25/37 (67.57%), Postives = 30/37 (81.08%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 S +I G+N A++LPGKCGVN+PYKIS S NCATVK Sbjct: 55 SGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK 91
BLAST of CF811157 vs. DB:swissprot:display
Match: NLTP_SPIOL (Non-specific lipid-transfer protein OS=Spinacia oleracea PE=1 SV=2) HSP 1 Score: 55.0694 bits (131), Expect = 1.354e-7 Identity = 23/36 (63.89%), Postives = 29/36 (80.56%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATV 109 ++AIKG+NYG A+ LPG CGV++PY ISPS NC V Sbjct: 81 ANAIKGINYGKAAGLPGMCGVHIPYAISPSTNCNAV 116
BLAST of CF811157 vs. DB:swissprot:display
Match: NLTP1_PRUDU (Non-specific lipid-transfer protein 1 OS=Prunus dulcis PE=3 SV=1) HSP 1 Score: 55.0694 bits (131), Expect = 1.354e-7 Identity = 23/37 (62.16%), Postives = 31/37 (83.78%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 S+++ G+N A++LPGKCGVN+PY+ISPS NCA VK Sbjct: 81 SASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANVK 117
BLAST of CF811157 vs. Populus trichocarpa peptide v2.0
Match: POPTR_1545s00200.1 () HSP 1 Score: 53.9138 bits (128), Expect = 2.776e-8 Identity = 23/34 (67.65%), Postives = 28/34 (82.35%), Query Frame = 2 Query: 11 IKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 I GLNYGLA+ LP KCGV++ YKISPS +C +VK Sbjct: 14 ISGLNYGLAAGLPSKCGVSISYKISPSTDCKSVK 47
BLAST of CF811157 vs. Populus trichocarpa peptide v2.0
Match: POPTR_0004s08500.1 () HSP 1 Score: 51.9878 bits (123), Expect = 1.055e-7 Identity = 21/34 (61.76%), Postives = 28/34 (82.35%), Query Frame = 2 Query: 11 IKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 I G+NYG+A+ LP KCGV++ YKISPS +C +VK Sbjct: 85 ISGINYGVAAGLPSKCGVSISYKISPSTDCKSVK 118
BLAST of CF811157 vs. P. persica 1.0 peptide
Match: ppa013554m () HSP 1 Score: 53.5286 bits (127), Expect = 2.495e-8 Identity = 23/37 (62.16%), Postives = 31/37 (83.78%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 S+++ G+N A++LPGKCGV++PYKIS S NCATVK Sbjct: 81 SASVPGVNPNNAAALPGKCGVSIPYKISASTNCATVK 117
BLAST of CF811157 vs. P. persica 1.0 peptide
Match: ppa013428m () HSP 1 Score: 51.9878 bits (123), Expect = 7.258e-8 Identity = 21/30 (70.00%), Postives = 26/30 (86.67%), Query Frame = 2 Query: 23 NYGLASSLPGKCGVNLPYKISPSINCATVK 112 N GLA+ LPGKCGVN+PYKISPS +C ++K Sbjct: 94 NAGLAAGLPGKCGVNIPYKISPSTDCKSIK 123
BLAST of CF811157 vs. P. persica 1.0 peptide
Match: ppa023110m () HSP 1 Score: 51.9878 bits (123), Expect = 7.258e-8 Identity = 23/37 (62.16%), Postives = 30/37 (81.08%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 S++I G+N A++LPGKCGV++PYKIS S NC TVK Sbjct: 82 SASIPGVNPNNAAALPGKCGVSIPYKISASTNCKTVK 118
BLAST of CF811157 vs. P. persica 1.0 peptide
Match: ppa013558m () HSP 1 Score: 49.6766 bits (117), Expect = 3.602e-7 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 + A+KG+N G A++LP CGV +PYKIS S NC +VK Sbjct: 80 AGAVKGINPGYAAALPSLCGVKIPYKISASTNCNSVK 116
BLAST of CF811157 vs. TrEMBL
Match: Q9M6T9|Q9M6T9_NICGL (Non-specific lipid-transfer protein OS=Nicotiana glauca GN=LTP1 PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 1.987e-9 Identity = 28/35 (80.00%), Postives = 34/35 (97.14%), Query Frame = 2 Query: 8 AIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 +I G+N+GLASSLPGKCGVNLPYKISPSI+C+TV+ Sbjct: 83 SISGINFGLASSLPGKCGVNLPYKISPSIDCSTVQ 117
BLAST of CF811157 vs. TrEMBL
Match: Q6E0V0|Q6E0V0_NICGL (Non-specific lipid-transfer protein OS=Nicotiana glauca GN=LTP4 PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 1.987e-9 Identity = 28/35 (80.00%), Postives = 34/35 (97.14%), Query Frame = 2 Query: 8 AIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 +I G+N+GLASSLPGKCGVNLPYKISPSI+C+TV+ Sbjct: 83 SISGINFGLASSLPGKCGVNLPYKISPSIDCSTVQ 117
BLAST of CF811157 vs. TrEMBL
Match: Q6E0V1|Q6E0V1_NICGL (Non-specific lipid-transfer protein OS=Nicotiana glauca GN=LTP3 PE=3 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 4.428e-9 Identity = 27/37 (72.97%), Postives = 35/37 (94.59%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 +++IKG+N+ LA SLPGKCGVNLPYKISPSI+C+TV+ Sbjct: 81 AASIKGINFSLAGSLPGKCGVNLPYKISPSIDCSTVQ 117
BLAST of CF811157 vs. TrEMBL
Match: Q5QJ48|Q5QJ48_9SOLA (Non-specific lipid-transfer protein OS=Nicotiana attenuata PE=3 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 1.682e-8 Identity = 27/36 (75.00%), Postives = 32/36 (88.89%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATV 109 ++AI G+NY LA SLP KCGVNLPYKISPSI+C+TV Sbjct: 81 AAAINGINYSLAGSLPSKCGVNLPYKISPSIDCSTV 116
BLAST of CF811157 vs. TrEMBL
Match: Q6E0U9|Q6E0U9_NICGL (Non-specific lipid-transfer protein OS=Nicotiana glauca GN=LTP5 PE=3 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.870e-8 Identity = 26/37 (70.27%), Postives = 34/37 (91.89%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 +++IKG+N+ A SLPGKCGVNLPYKISPSI+C+TV+ Sbjct: 81 AASIKGINFSHAGSLPGKCGVNLPYKISPSIDCSTVQ 117
BLAST of CF811157 vs. TrEMBL
Match: Q9M6B8|Q9M6B8_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum GN=FSltp1 PE=3 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 3.748e-8 Identity = 25/37 (67.57%), Postives = 32/37 (86.49%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 ++ I G+NYG+AS LPGKCGVN+PYKISPS +C+ VK Sbjct: 84 AAGIPGINYGIASGLPGKCGVNIPYKISPSTDCSRVK 120
BLAST of CF811157 vs. TrEMBL
Match: Q9M6B6|Q9M6B6_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum GN=FSltp3 PE=3 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 3.748e-8 Identity = 25/37 (67.57%), Postives = 33/37 (89.19%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 ++ I G+N+GLAS LPGKCGVN+PYKISPS +C++VK Sbjct: 84 AAGIPGINFGLASGLPGKCGVNIPYKISPSTDCSSVK 120
BLAST of CF811157 vs. TrEMBL
Match: Q8GT85|Q8GT85_GOSBA (Non-specific lipid-transfer protein OS=Gossypium barbadense PE=3 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 3.748e-8 Identity = 25/37 (67.57%), Postives = 32/37 (86.49%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 ++ I G+NYG+AS LPGKCGVN+PYKISPS +C +VK Sbjct: 84 AAGISGINYGIASGLPGKCGVNIPYKISPSTDCNSVK 120
BLAST of CF811157 vs. TrEMBL
Match: O49200|O49200_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum GN=LTP PE=3 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 3.748e-8 Identity = 25/37 (67.57%), Postives = 32/37 (86.49%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 ++ I G+NYG+AS LPGKCGVN+PYKISPS +C +VK Sbjct: 84 AAGISGINYGIASGLPGKCGVNIPYKISPSTDCNSVK 120
BLAST of CF811157 vs. TrEMBL
Match: A7TUG4|A7TUG4_GOSHI (Non-specific lipid-transfer protein OS=Gossypium hirsutum GN=FSltp4 PE=3 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 3.748e-8 Identity = 25/37 (67.57%), Postives = 32/37 (86.49%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 ++ I G+NYG+AS LPGKCGVN+PYKISPS +C +VK Sbjct: 84 AAGISGINYGIASGLPGKCGVNIPYKISPSTDCNSVK 120
BLAST of CF811157 vs. Vitis vinifera peptide
Match: GSVIVT01030190001 (assembled CDS) HSP 1 Score: 59.3066 bits (142), Expect = 3.984e-10 Identity = 25/36 (69.44%), Postives = 30/36 (83.33%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATV 109 S +I G+N+GLA+ LPGKCGVN+PYKISPS NC V Sbjct: 103 SKSISGVNFGLAAGLPGKCGVNIPYKISPSTNCDQV 138
BLAST of CF811157 vs. Vitis vinifera peptide
Match: GSVIVT01024563001 (assembled CDS) HSP 1 Score: 48.9062 bits (115), Expect = 5.385e-7 Identity = 19/36 (52.78%), Postives = 29/36 (80.56%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATV 109 ++ I G++Y L +SLP +CGV+LPYKISPS +C+ + Sbjct: 83 AAMIPGIDYNLVASLPSQCGVSLPYKISPSTDCSRI 118
BLAST of CF811157 vs. TAIR peptide
Match: AT5G59310.1 (| Symbols: LTP4 | lipid transfer protein 4 | chr5:23925296-23925772 REVERSE LENGTH=112) HSP 1 Score: 55.8398 bits (133), Expect = 6.111e-9 Identity = 25/36 (69.44%), Postives = 29/36 (80.56%), Query Frame = 2 Query: 5 SAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 SA KG+N LAS LPGKCGV++PY IS S NCAT+K Sbjct: 77 SAAKGVNPSLASGLPGKCGVSIPYPISTSTNCATIK 112
BLAST of CF811157 vs. TAIR peptide
Match: AT5G59320.1 (| Symbols: LTP3 | lipid transfer protein 3 | chr5:23929051-23929492 FORWARD LENGTH=115) HSP 1 Score: 50.0618 bits (118), Expect = 3.353e-7 Identity = 22/37 (59.46%), Postives = 27/37 (72.97%), Query Frame = 2 Query: 2 SSAIKGLNYGLASSLPGKCGVNLPYKISPSINCATVK 112 + +I GLN LAS LPGKCGV++PY IS S NC +K Sbjct: 79 AKSISGLNPSLASGLPGKCGVSIPYPISMSTNCNNIK 115 The following BLAST results are available for this feature:
BLAST of CF811157 vs. DB:swissprot:display
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot) Total hits: 10
BLAST of CF811157 vs. Populus trichocarpa peptide v2.0
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide) Total hits: 2
BLAST of CF811157 vs. P. persica 1.0 peptide
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide) Total hits: 4
BLAST of CF811157 vs. TrEMBL
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL) Total hits: 10
BLAST of CF811157 vs. Vitis vinifera peptide
Analysis Date: 2011-01-25 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide) Total hits: 2
BLAST of CF811157 vs. TAIR peptide
Analysis Date: 2011-02-10 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF811157 ID=CF811157; Name=CF811157; organism=Vaccinium corymbosum; type=EST; length=354bpback to top |