DW043413
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DW043413 vs. TrEMBL
Match: B2BJD0|B2BJD0_RHOCT (Early light-induced protein 1 OS=Rhododendron catawbiense PE=2 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 6.616e-8 Identity = 30/46 (65.22%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 175 VSPVTGVARGLGYSRTATSSYMPPRQQRNSGRVVRCMAEDSKEEEV 312 VSPVTGVA+G G SRT S PRQ RNSG +VRCMA+D ++EEV Sbjct: 12 VSPVTGVAKGAGLSRTIPRSCYLPRQGRNSGMLVRCMAKDGRKEEV 57
BLAST of DW043413 vs. TrEMBL
Match: B2BJD2|B2BJD2_RHOCT (Early light-induced protein 3 OS=Rhododendron catawbiense PE=2 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 1.129e-7 Identity = 30/46 (65.22%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 175 VSPVTGVARGLGYSRTATSSYMPPRQQRNSGRVVRCMAEDSKEEEV 312 VSPVTGVA+G G SRT S PRQ R+SG +VRCMA+D K+EEV Sbjct: 12 VSPVTGVAKGAGLSRTIPRSSYLPRQGRDSGMLVRCMAKDGKKEEV 57
BLAST of DW043413 vs. TrEMBL
Match: B2BJD1|B2BJD1_RHOCT (Early light-induced protein 2 OS=Rhododendron catawbiense PE=2 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.474e-7 Identity = 29/46 (63.04%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 175 VSPVTGVARGLGYSRTATSSYMPPRQQRNSGRVVRCMAEDSKEEEV 312 VSPVTGVA+G G +RT S PRQ RNSG +VRCMA+D ++EEV Sbjct: 12 VSPVTGVAKGAGLNRTIPRSCYLPRQGRNSGMLVRCMAKDGRKEEV 57 The following BLAST results are available for this feature:
BLAST of DW043413 vs. TrEMBL
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Vaccinium corymbosum unigene v1
Date Performed: 2011-01-18
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DW043413 ID=DW043413; Name=DW043413; organism=Vaccinium corymbosum; type=EST; length=552bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|