DR068167
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DR068167 vs. Populus trichocarpa peptide v2.0
Match: POPTR_0005s22280.1 () HSP 1 Score: 69.3218 bits (168), Expect = 7.280e-13 Identity = 32/44 (72.73%), Postives = 36/44 (81.82%), Query Frame = 3 Query: 39 VDRRFPFTTQQVRDNFVQATGSNKAAAAQARVFKLANEGRLKPR 170 V RFPFTT+QVR+NF+ A SNKAA AQ +FKLANEGRLKPR Sbjct: 247 VSNRFPFTTRQVRENFISALASNKAAGAQGHLFKLANEGRLKPR 290
BLAST of DR068167 vs. Populus trichocarpa peptide v2.0
Match: POPTR_0002s06160.1 () HSP 1 Score: 68.1662 bits (165), Expect = 1.622e-12 Identity = 32/44 (72.73%), Postives = 36/44 (81.82%), Query Frame = 3 Query: 39 VDRRFPFTTQQVRDNFVQATGSNKAAAAQARVFKLANEGRLKPR 170 V RFPFTT+QVR+NFV + SNKAA AQ +FKLANEGRLKPR Sbjct: 229 VSNRFPFTTRQVRENFVASLASNKAAGAQGHLFKLANEGRLKPR 272
BLAST of DR068167 vs. P. persica 1.0 peptide
Match: ppa027080m () HSP 1 Score: 70.4774 bits (171), Expect = 2.388e-13 Identity = 35/44 (79.55%), Postives = 39/44 (88.64%), Query Frame = 3 Query: 39 VDRRFPFTTQQVRDNFVQATGSNKAAAAQARVFKLANEGRLKPR 170 VD RF FTT+QVRD+FV A GSNKAAA+QARVFKLANEG+LK R Sbjct: 211 VDNRFHFTTKQVRDSFVGALGSNKAAASQARVFKLANEGKLKSR 254
BLAST of DR068167 vs. TrEMBL
Match: B9S314|B9S314_RICCO (Copper ion binding protein, putative OS=Ricinus communis GN=RCOM_1194180 PE=4 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 6.360e-11 Identity = 32/45 (71.11%), Postives = 38/45 (84.44%), Query Frame = 3 Query: 39 VDRRFPFTTQQVRDNFVQATGSNKAAAAQARVFKLANEGRLKPRN 173 V +FPFTT+QVR++F+ A GSNK AAAQ +FKLANEGRLKPRN Sbjct: 240 VSNKFPFTTRQVRESFIAALGSNKVAAAQGHLFKLANEGRLKPRN 284
BLAST of DR068167 vs. TrEMBL
Match: B9H802|B9H802_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_559462 PE=4 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.417e-10 Identity = 32/44 (72.73%), Postives = 36/44 (81.82%), Query Frame = 3 Query: 39 VDRRFPFTTQQVRDNFVQATGSNKAAAAQARVFKLANEGRLKPR 170 V RFPFTT+QVR+NF+ A SNKAA AQ +FKLANEGRLKPR Sbjct: 47 VSNRFPFTTRQVRENFISALASNKAAGAQGHLFKLANEGRLKPR 90
BLAST of DR068167 vs. TrEMBL
Match: B5G4Z8|B5G4Z8_GOSBA (PDF OS=Gossypium barbadense PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.417e-10 Identity = 33/44 (75.00%), Postives = 38/44 (86.36%), Query Frame = 3 Query: 39 VDRRFPFTTQQVRDNFVQATGSNKAAAAQARVFKLANEGRLKPR 170 V+ RFPF+T+QVR+ FV A GSN AAAAQAR+FKLANEG LKPR Sbjct: 250 VNNRFPFSTKQVRETFVAALGSNSAAAAQARLFKLANEGHLKPR 293
BLAST of DR068167 vs. TrEMBL
Match: Q9S728|Q9S728_ARATH (At2g42840 OS=Arabidopsis thaliana GN=PDF1 PE=2 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 2.672e-9 Identity = 31/44 (70.45%), Postives = 34/44 (77.27%), Query Frame = 3 Query: 39 VDRRFPFTTQQVRDNFVQATGSNKAAAAQARVFKLANEGRLKPR 170 V+ +FPFTT QVRD+FV SNKAA QA FKLANEGRLKPR Sbjct: 262 VNHKFPFTTPQVRDHFVAGLSSNKAATKQAHTFKLANEGRLKPR 305
BLAST of DR068167 vs. TrEMBL
Match: C6TLZ6|C6TLZ6_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 2.672e-9 Identity = 29/44 (65.91%), Postives = 37/44 (84.09%), Query Frame = 3 Query: 39 VDRRFPFTTQQVRDNFVQATGSNKAAAAQARVFKLANEGRLKPR 170 V+ +FP+TT QVRD FV + SNKAA AQA++FK+ANEGR+KPR Sbjct: 226 VNNKFPYTTNQVRDRFVASLNSNKAAEAQAQLFKMANEGRMKPR 269
BLAST of DR068167 vs. TrEMBL
Match: C6TBQ8|C6TBQ8_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 2.672e-9 Identity = 29/44 (65.91%), Postives = 37/44 (84.09%), Query Frame = 3 Query: 39 VDRRFPFTTQQVRDNFVQATGSNKAAAAQARVFKLANEGRLKPR 170 V+ +FP+TT QVRD FV + SNKAA AQA++FK+ANEGR+KPR Sbjct: 220 VNNKFPYTTNQVRDRFVASLNSNKAAEAQAQLFKMANEGRMKPR 263
BLAST of DR068167 vs. TAIR peptide
Match: AT2G42840.1 (| Symbols: PDF1 | protodermal factor 1 | chr2:17826327-17827426 REVERSE LENGTH=306) HSP 1 Score: 65.0846 bits (157), Expect = 1.227e-11 Identity = 31/44 (70.45%), Postives = 34/44 (77.27%), Query Frame = 3 Query: 39 VDRRFPFTTQQVRDNFVQATGSNKAAAAQARVFKLANEGRLKPR 170 V+ +FPFTT QVRD+FV SNKAA QA FKLANEGRLKPR Sbjct: 262 VNHKFPFTTPQVRDHFVAGLSSNKAATKQAHTFKLANEGRLKPR 305 The following BLAST results are available for this feature:
BLAST of DR068167 vs. Populus trichocarpa peptide v2.0
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide) Total hits: 2
BLAST of DR068167 vs. P. persica 1.0 peptide
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide) Total hits: 1
BLAST of DR068167 vs. TrEMBL
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL) Total hits: 6
BLAST of DR068167 vs. TAIR peptide
Analysis Date: 2011-02-10 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DR068167 ID=DR068167; Name=DR068167; organism=Vaccinium corymbosum; type=EST; length=382bpback to top |