DW043442
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DW043442 vs. Populus trichocarpa peptide v2.0
Match: POPTR_0002s05910.1 () HSP 1 Score: 52.373 bits (124), Expect = 2.242e-7 Identity = 29/55 (52.73%), Postives = 32/55 (58.18%), Query Frame = -3 Query: 372 LSFQKEETSR*QAYLNVVSQRNDSVFFATIGAXXXXXXXXXXXXXXFTGYVLLFP 536 L+ ++ R QAYLN VSQRNDSVFFATIGA TGYV LFP Sbjct: 132 LTVSQKRNIRRQAYLNQVSQRNDSVFFATIGAFIILPPIIILGIAILTGYVQLFP 186
BLAST of DW043442 vs. P. persica 1.0 peptide
Match: ppa011966m () HSP 1 Score: 50.447 bits (119), Expect = 6.047e-7 Identity = 27/56 (48.21%), Postives = 33/56 (58.93%), Query Frame = -3 Query: 372 KLSFQKEETSR*QAYLNVVSQRNDSVFFATIGAXXXXXXXXXXXXXXFTGYVLLFP 539 +L+ ++ + QAYLN VS+RNDSVFFATIGA TGYV LFP Sbjct: 134 ELTISQKRNIKRQAYLNEVSKRNDSVFFATIGAFVLVPPLVILGIAILTGYVQLFP 189
BLAST of DW043442 vs. Vitis vinifera peptide
Match: GSVIVT01020847001 (assembled CDS) HSP 1 Score: 55.8398 bits (133), Expect = 1.234e-8 Identity = 34/60 (56.67%), Postives = 36/60 (60.00%), Query Frame = -3 Query: 372 PRFLKLSFQKEETSR*QAYLNVVSQRNDSVFFATIGAXXXXXXXXXXXXXXFTGYVLLFP 551 P+FL +S QK R QAYLN VSQRNDSVFFATIGA TGYV LFP Sbjct: 133 PKFLTIS-QKRNIKR-QAYLNEVSQRNDSVFFATIGAFVILPPIIILGIAIITGYVQLFP 190
BLAST of DW043442 vs. TAIR peptide
Match: AT2G42975.1 (| Symbols: | unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast thylakoid membrane, chloroplast; Has 32 Blast hits to 32 proteins in 16 species: Archae - 0; Bacteria - 0; Metazoa - 2; Fungi - 2; Plants - 28; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:17873998-17874820 FORWARD LENGTH=187) HSP 1 Score: 54.6842 bits (130), Expect = 3.983e-8 Identity = 33/60 (55.00%), Postives = 36/60 (60.00%), Query Frame = -3 Query: 372 PRFLKLSFQKEETSR*QAYLNVVSQRNDSVFFATIGAXXXXXXXXXXXXXXFTGYVLLFP 551 P+FL +S QK R Q+YLN VSQRNDSVFFATIGA TGYV LFP Sbjct: 130 PKFLTIS-QKRNIKR-QSYLNEVSQRNDSVFFATIGAFVILPPLVILAIAILTGYVQLFP 187 The following BLAST results are available for this feature:
BLAST of DW043442 vs. Populus trichocarpa peptide v2.0
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide) Total hits: 1
BLAST of DW043442 vs. P. persica 1.0 peptide
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide) Total hits: 1
BLAST of DW043442 vs. Vitis vinifera peptide
Analysis Date: 2011-01-25 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide) Total hits: 1
BLAST of DW043442 vs. TAIR peptide
Analysis Date: 2011-02-10 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Vaccinium corymbosum unigene v1
Date Performed: 2011-01-18
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DW043442 ID=DW043442; Name=DW043442; organism=Vaccinium corymbosum; type=EST; length=565bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|