CV191380
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CV191380 vs. Populus trichocarpa peptide v2.0
Match: POPTR_0017s02430.1 () HSP 1 Score: 53.1434 bits (126), Expect = 1.631e-7 Identity = 34/73 (46.58%), Postives = 42/73 (57.53%), Query Frame = 3 Query: 9 DQIKSSRGSRLNLINRELGFEQP---------ARKISGTERVVNGIRDLSKCMIIHPDN---RKWSDFNLILA 191 D+IKSSRGSR NLI +E G RK+S E V+NGIR +S +IHPDN R W+ F L+ A Sbjct: 31 DRIKSSRGSRFNLIEKEFGLVNNNGSSSMTSWRRKLS-RESVINGIRYVSSGFVIHPDNRWYRAWTKFILLWA 102
BLAST of CV191380 vs. P. persica 1.0 peptide
Match: ppa001431m () HSP 1 Score: 51.2174 bits (121), Expect = 4.436e-7 Identity = 30/67 (44.78%), Postives = 41/67 (61.19%), Query Frame = 3 Query: 9 DQIKSSRGSRLNLINRELGFEQPARKI---SGTERVVNGIRDLSKCMIIHPDN---RKWSDFNLILA 191 D+IKSSRGSR NLI ELG + + I + ++NG++ LS +IHPDN R W+ F L+ A Sbjct: 29 DRIKSSRGSRFNLIKNELGLDDDSSSILRRFSRQSLINGVKGLSH-GVIHPDNWWYRAWTKFILVWA 94 The following BLAST results are available for this feature:
BLAST of CV191380 vs. Populus trichocarpa peptide v2.0
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide) Total hits: 1
BLAST of CV191380 vs. P. persica 1.0 peptide
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Vaccinium corymbosum unigene v1
Date Performed: 2011-01-18
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CV191380 ID=CV191380; Name=CV191380; organism=Vaccinium corymbosum; type=EST; length=638bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|