HO054791
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO054791 vs. DB:swissprot:display
Match: ACL1_SCHPO (Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe GN=SPBC1703.07 PE=1 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 2.438e-9 Identity = 28/42 (66.67%), Postives = 31/42 (73.81%), Query Frame = 3 Query: 24 LRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLY 149 + L I G VL RSIGLIGH DQKRL+ PLYRHPW+D LY Sbjct: 572 INLGILNGMFVLGRSIGLIGHHLDQKRLRAPLYRHPWDDFLY 613
BLAST of HO054791 vs. DB:swissprot:display
Match: ACLY_SHEEP (ATP-citrate synthase OS=Ovis aries GN=ACLY PE=2 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 6.005e-8 Identity = 24/35 (68.57%), Postives = 27/35 (77.14%), Query Frame = 3 Query: 45 GSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLY 149 G VL RS+G IGH DQKRLKQ LYRHPW+D+ Y Sbjct: 1059 GIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISY 1093
BLAST of HO054791 vs. DB:swissprot:display
Match: ACLY_RAT (ATP-citrate synthase OS=Rattus norvegicus GN=Acly PE=1 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 6.005e-8 Identity = 24/35 (68.57%), Postives = 27/35 (77.14%), Query Frame = 3 Query: 45 GSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLY 149 G VL RS+G IGH DQKRLKQ LYRHPW+D+ Y Sbjct: 1058 GVFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISY 1092
BLAST of HO054791 vs. DB:swissprot:display
Match: ACLY_MOUSE (ATP-citrate synthase OS=Mus musculus GN=Acly PE=1 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 6.005e-8 Identity = 24/35 (68.57%), Postives = 27/35 (77.14%), Query Frame = 3 Query: 45 GSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLY 149 G VL RS+G IGH DQKRLKQ LYRHPW+D+ Y Sbjct: 1049 GIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISY 1083
BLAST of HO054791 vs. DB:swissprot:display
Match: ACLY_HUMAN (ATP-citrate synthase OS=Homo sapiens GN=ACLY PE=1 SV=3) HSP 1 Score: 56.225 bits (134), Expect = 6.005e-8 Identity = 24/35 (68.57%), Postives = 27/35 (77.14%), Query Frame = 3 Query: 45 GSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLY 149 G VL RS+G IGH DQKRLKQ LYRHPW+D+ Y Sbjct: 1059 GIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISY 1093
BLAST of HO054791 vs. DB:swissprot:display
Match: ACLY_BOVIN (ATP-citrate synthase OS=Bos taurus GN=ACLY PE=2 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 6.005e-8 Identity = 24/35 (68.57%), Postives = 27/35 (77.14%), Query Frame = 3 Query: 45 GSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLY 149 G VL RS+G IGH DQKRLKQ LYRHPW+D+ Y Sbjct: 1049 GIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISY 1083
BLAST of HO054791 vs. DB:swissprot:display
Match: ACLY_CAEEL (Probable ATP-citrate synthase OS=Caenorhabditis elegans GN=D1005.1 PE=2 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 1.024e-7 Identity = 24/35 (68.57%), Postives = 26/35 (74.29%), Query Frame = 3 Query: 45 GSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLY 149 G VL RSIG IGH DQ RLKQ LYRHPW+D+ Y Sbjct: 1062 GLFVLGRSIGFIGHYLDQSRLKQGLYRHPWDDISY 1096
BLAST of HO054791 vs. DB:swissprot:display
Match: ACL1_SORMA (ATP-citrate synthase subunit 1 OS=Sordaria macrospora GN=ACL1 PE=3 SV=1) HSP 1 Score: 53.5286 bits (127), Expect = 3.893e-7 Identity = 23/35 (65.71%), Postives = 26/35 (74.29%), Query Frame = 3 Query: 45 GSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLY 149 G VL RSIGLI H DQKRL+ LYRHPW+D+ Y Sbjct: 619 GLFVLGRSIGLIAHYLDQKRLRTGLYRHPWDDITY 653
BLAST of HO054791 vs. DB:swissprot:display
Match: ACL1_NEUCR (Probable ATP-citrate synthase subunit 1 OS=Neurospora crassa GN=B14D6.310 PE=3 SV=1) HSP 1 Score: 53.5286 bits (127), Expect = 3.893e-7 Identity = 23/35 (65.71%), Postives = 26/35 (74.29%), Query Frame = 3 Query: 45 GSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLY 149 G VL RSIGLI H DQKRL+ LYRHPW+D+ Y Sbjct: 615 GLFVLGRSIGLIAHYLDQKRLRTGLYRHPWDDITY 649
BLAST of HO054791 vs. Populus trichocarpa peptide v2.0
Match: POPTR_0010s15590.1 () HSP 1 Score: 76.6406 bits (187), Expect = 4.082e-15 Identity = 35/37 (94.59%), Postives = 35/37 (94.59%), Query Frame = 3 Query: 45 GSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 580 GLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 616
BLAST of HO054791 vs. Populus trichocarpa peptide v2.0
Match: POPTR_0008s10480.1 () HSP 1 Score: 76.2554 bits (186), Expect = 5.331e-15 Identity = 36/51 (70.59%), Postives = 41/51 (80.39%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++ + G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLY+K Sbjct: 558 KQEIDEIVGIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYSK 608
BLAST of HO054791 vs. P. persica 1.0 peptide
Match: ppa003053m () HSP 1 Score: 77.7962 bits (190), Expect = 1.215e-15 Identity = 37/51 (72.55%), Postives = 41/51 (80.39%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++ + G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIVDIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608
BLAST of HO054791 vs. TrEMBL
Match: A9S3S9|A9S3S9_PHYPA (Predicted protein OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_208338 PE=4 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 1.364e-13 Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++++ G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIIQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608
BLAST of HO054791 vs. TrEMBL
Match: Q9FGX1|Q9FGX1_ARATH (ATP citrate lyase OS=Arabidopsis thaliana GN=At5g49460 PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 1.781e-13 Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++++ G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608
BLAST of HO054791 vs. TrEMBL
Match: Q9C522|Q9C522_ARATH (ATP citrate lyase, putative; 3734-7120 OS=Arabidopsis thaliana GN=T8E24.7 PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 1.781e-13 Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++++ G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608
BLAST of HO054791 vs. TrEMBL
Match: Q570J1|Q570J1_ARATH (ATP-citrate lyase subunit B (Fragment) OS=Arabidopsis thaliana GN=At5g49460 PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 1.781e-13 Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++++ G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 133 KQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 183
BLAST of HO054791 vs. TrEMBL
Match: D7SYK8|D7SYK8_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_77.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00034990001 PE=4 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 1.781e-13 Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++++ G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608
BLAST of HO054791 vs. TrEMBL
Match: D7MNS5|D7MNS5_ARALY (ATP-citrate lyase B-2 OS=Arabidopsis lyrata subsp. lyrata GN=ACLB-2 PE=4 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 1.781e-13 Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++++ G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608
BLAST of HO054791 vs. TrEMBL
Match: D7L5X9|D7L5X9_ARALY (ATP-citrate lyase B-1 OS=Arabidopsis lyrata subsp. lyrata GN=ACLB-1 PE=4 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 1.781e-13 Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++++ G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608
BLAST of HO054791 vs. TrEMBL
Match: Q93YH4|Q93YH4_LUPAL (ATP citrate lyase a-subunit OS=Lupinus albus GN=acla PE=2 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 2.326e-13 Identity = 37/51 (72.55%), Postives = 41/51 (80.39%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++ + G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608
BLAST of HO054791 vs. TrEMBL
Match: Q93VT8|Q93VT8_ORYSJ (Os01g0300200 protein OS=Oryza sativa subsp. japonica GN=P0487H02.31 PE=4 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 2.326e-13 Identity = 37/51 (72.55%), Postives = 41/51 (80.39%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++ + G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608
BLAST of HO054791 vs. TrEMBL
Match: C0HIN7|C0HIN7_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 2.326e-13 Identity = 37/51 (72.55%), Postives = 41/51 (80.39%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++ + G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 151 KQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 201
BLAST of HO054791 vs. Vitis vinifera peptide
Match: GSVIVT01034990001 (assembled CDS) HSP 1 Score: 78.9518 bits (193), Expect = 4.627e-16 Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++++ G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608
BLAST of HO054791 vs. TAIR peptide
Match: AT5G49460.1 (| Symbols: ACLB-2 | ATP citrate lyase subunit B 2 | chr5:20055048-20058195 FORWARD LENGTH=608) HSP 1 Score: 78.9518 bits (193), Expect = 6.866e-16 Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++++ G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608
BLAST of HO054791 vs. TAIR peptide
Match: AT3G06650.1 (| Symbols: ACLB-1 | ATP-citrate lyase B-1 | chr3:2079247-2082633 REVERSE LENGTH=608) HSP 1 Score: 78.9518 bits (193), Expect = 6.866e-16 Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = 3 Query: 3 KQRLMRLLRLVISVGSVVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 155 KQ + ++++ G VLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK Sbjct: 558 KQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHPWEDVLYTK 608 The following BLAST results are available for this feature:
BLAST of HO054791 vs. DB:swissprot:display
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs Swissprot) Total hits: 9
BLAST of HO054791 vs. Populus trichocarpa peptide v2.0
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide) Total hits: 2
BLAST of HO054791 vs. P. persica 1.0 peptide
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs Ppersica v1.0 peptide) Total hits: 1
BLAST of HO054791 vs. TrEMBL
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL) Total hits: 10
BLAST of HO054791 vs. Vitis vinifera peptide
Analysis Date: 2011-01-25 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide) Total hits: 1
BLAST of HO054791 vs. TAIR peptide
Analysis Date: 2011-02-10 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Vaccinium corymbosum unigene v1
Date Performed: 2011-01-18
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO054791 ID=HO054791; Name=HO054791; organism=Vaccinium corymbosum; type=EST; length=337bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|