CF811024
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF811024 vs. Populus trichocarpa peptide v2.0
Match: POPTR_0003s17320.1 () HSP 1 Score: 52.373 bits (124), Expect = 3.037e-7 Identity = 27/41 (65.85%), Postives = 29/41 (70.73%), Query Frame = 3 Query: 6 P*GAASGAIFGHLLTTSIAILGGGFLANIISEKLAGPNLSH 128 P G A+GAI GHL+ TSIAILGG FLAN ISEKL H Sbjct: 214 PWGVATGAIAGHLVATSIAILGGAFLANYISEKLVRAATMH 254
BLAST of CF811024 vs. Vitis vinifera peptide
Match: GSVIVT01029035001 (assembled CDS) HSP 1 Score: 53.9138 bits (128), Expect = 6.370e-8 Identity = 27/36 (75.00%), Postives = 28/36 (77.78%), Query Frame = 3 Query: 6 P*GAASGAIFGHLLTTSIAILGGGFLANIISEKLAG 113 P G ASGAI GHL T+IAILGG FLAN ISEKL G Sbjct: 300 PWGVASGAIAGHLFATTIAILGGAFLANYISEKLVG 335
BLAST of CF811024 vs. TAIR peptide
Match: AT4G13590.2 (| Symbols: | Uncharacterized protein family (UPF0016) | chr4:7901369-7903792 REVERSE LENGTH=359) HSP 1 Score: 51.6026 bits (122), Expect = 4.561e-7 Identity = 25/36 (69.44%), Postives = 28/36 (77.78%), Query Frame = 3 Query: 6 P*GAASGAIFGHLLTTSIAILGGGFLANIISEKLAG 113 P G ASGAI GHL+ T +AI+GG FLAN ISEKL G Sbjct: 305 PLGVASGAIAGHLVATVLAIMGGAFLANYISEKLVG 340
BLAST of CF811024 vs. TAIR peptide
Match: AT4G13590.1 (| Symbols: | Uncharacterized protein family (UPF0016) | chr4:7901369-7903792 REVERSE LENGTH=359) HSP 1 Score: 51.6026 bits (122), Expect = 4.561e-7 Identity = 25/36 (69.44%), Postives = 28/36 (77.78%), Query Frame = 3 Query: 6 P*GAASGAIFGHLLTTSIAILGGGFLANIISEKLAG 113 P G ASGAI GHL+ T +AI+GG FLAN ISEKL G Sbjct: 305 PLGVASGAIAGHLVATVLAIMGGAFLANYISEKLVG 340 The following BLAST results are available for this feature:
BLAST of CF811024 vs. Populus trichocarpa peptide v2.0
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs Populus trichocarpa v2.0 peptide) Total hits: 1
BLAST of CF811024 vs. Vitis vinifera peptide
Analysis Date: 2011-01-25 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide) Total hits: 1
BLAST of CF811024 vs. TAIR peptide
Analysis Date: 2011-02-10 (BLAST: Vaccinium corymbosum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Vaccinium corymbosum unigene v1
Date Performed: 2011-01-18
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF811024 ID=CF811024; Name=CF811024; organism=Vaccinium corymbosum; type=EST; length=675bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|