CF810440
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF810440 vs. TrEMBL
Match: A5AG81|A5AG81_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_009094 PE=4 SV=1) HSP 1 Score: 51.2174 bits (121), Expect = 3.914e-7 Identity = 28/66 (42.42%), Postives = 38/66 (57.58%), Query Frame = 2 Query: 344 LCVITMAKKAVSKSLAFDNFQLQAGHAYGADPSSSGTVEAPQH*FQETVTSQQEGGSPMIPNRGNY 541 + + T +K V K++ FDN Q G AYGAD SS G V++ QH +QET +Q + P P NY Sbjct: 743 IALSTEPEKEVPKTMPFDNSQ---GLAYGADQSSYGVVDSSQHYYQETAPTQMQSSVPGSPYGDNY 805 HSP 2 Score: 27.335 bits (59), Expect = 3.914e-7 Identity = 11/14 (78.57%), Postives = 12/14 (85.71%), Query Frame = 1 Query: 565 PQMFVPSQAPQVQQ 606 P MF+PSQAPQV Q Sbjct: 830 PHMFLPSQAPQVPQ 843
BLAST of CF810440 vs. TrEMBL
Match: D7TDM4|D7TDM4_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_158.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00001441001 PE=4 SV=1) HSP 1 Score: 51.2174 bits (121), Expect = 3.917e-7 Identity = 28/66 (42.42%), Postives = 38/66 (57.58%), Query Frame = 2 Query: 344 LCVITMAKKAVSKSLAFDNFQLQAGHAYGADPSSSGTVEAPQH*FQETVTSQQEGGSPMIPNRGNY 541 + + T +K V K++ FDN Q G AYGAD SS G V++ QH +QET +Q + P P NY Sbjct: 700 IALSTEPEKEVPKTMPFDNSQ---GLAYGADQSSYGVVDSSQHYYQETAPTQMQSSVPGSPYGDNY 762 HSP 2 Score: 27.335 bits (59), Expect = 3.917e-7 Identity = 11/14 (78.57%), Postives = 12/14 (85.71%), Query Frame = 1 Query: 565 PQMFVPSQAPQVQQ 606 P MF+PSQAPQV Q Sbjct: 787 PHMFLPSQAPQVPQ 800
BLAST of CF810440 vs. Vitis vinifera peptide
Match: GSVIVT01001441001 (assembled CDS) HSP 1 Score: 51.2174 bits (121), Expect = 1.921e-9 Identity = 28/66 (42.42%), Postives = 38/66 (57.58%), Query Frame = 2 Query: 344 LCVITMAKKAVSKSLAFDNFQLQAGHAYGADPSSSGTVEAPQH*FQETVTSQQEGGSPMIPNRGNY 541 + + T +K V K++ FDN Q G AYGAD SS G V++ QH +QET +Q + P P NY Sbjct: 700 IALSTEPEKEVPKTMPFDNSQ---GLAYGADQSSYGVVDSSQHYYQETAPTQMQSSVPGSPYGDNY 762 HSP 2 Score: 27.335 bits (59), Expect = 1.921e-9 Identity = 11/14 (78.57%), Postives = 12/14 (85.71%), Query Frame = 1 Query: 565 PQMFVPSQAPQVQQ 606 P MF+PSQAPQV Q Sbjct: 787 PHMFLPSQAPQVPQ 800 The following BLAST results are available for this feature:
BLAST of CF810440 vs. TrEMBL
Analysis Date: 2011-01-18 (BLAST: Vaccinium corymbosum unigene v1 vs TrEMBL) Total hits: 2
BLAST of CF810440 vs. Vitis vinifera peptide
Analysis Date: 2011-01-25 (BLAST: Vaccinium corymbosum unigene v1 vs Vitis vinifera peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF810440 ID=CF810440; Name=CF810440; organism=Vaccinium corymbosum; type=EST; length=639bpback to top |